Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5QYD4

Protein Details
Accession E5QYD4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-185SQNGVRKRGLPRRSQRIAKKQRQKKVGAKRVEKASAHydrophilic
NLS Segment(s)
PositionSequence
143-199KKLRKSPSQNGVRKRGLPRRSQRIAKKQRQKKVGAKRVEKASAAPASKIKKRQQRGK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLAQRPLTPPYTAPRDPEPTQYNLPRENDTLLTELSGRCNTSLQSTLSKPTFRRLAEEVISKNVGSKSTKDTRDLEPRIHFTVSQAAQKLSQQATTTVNGIYFELTKLLPQRLQPFLLNFIGKEASEEDRYTFIINVLPWVLKKLRKSPSQNGVRKRGLPRRSQRIAKKQRQKKVGAKRVEKASAAPASKIKKRQQRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.47
4 0.53
5 0.5
6 0.47
7 0.52
8 0.55
9 0.54
10 0.52
11 0.53
12 0.48
13 0.46
14 0.43
15 0.36
16 0.31
17 0.28
18 0.22
19 0.19
20 0.17
21 0.16
22 0.16
23 0.16
24 0.15
25 0.14
26 0.15
27 0.15
28 0.17
29 0.19
30 0.18
31 0.22
32 0.23
33 0.28
34 0.3
35 0.34
36 0.32
37 0.35
38 0.39
39 0.35
40 0.38
41 0.35
42 0.37
43 0.36
44 0.4
45 0.35
46 0.32
47 0.32
48 0.27
49 0.26
50 0.22
51 0.21
52 0.18
53 0.19
54 0.23
55 0.3
56 0.33
57 0.34
58 0.36
59 0.4
60 0.48
61 0.48
62 0.46
63 0.41
64 0.43
65 0.41
66 0.38
67 0.32
68 0.23
69 0.27
70 0.24
71 0.23
72 0.21
73 0.19
74 0.19
75 0.19
76 0.22
77 0.16
78 0.15
79 0.13
80 0.14
81 0.15
82 0.15
83 0.15
84 0.12
85 0.11
86 0.1
87 0.1
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.09
95 0.1
96 0.11
97 0.14
98 0.18
99 0.19
100 0.22
101 0.22
102 0.2
103 0.23
104 0.23
105 0.21
106 0.16
107 0.15
108 0.14
109 0.12
110 0.12
111 0.11
112 0.11
113 0.13
114 0.13
115 0.13
116 0.14
117 0.14
118 0.14
119 0.12
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.09
127 0.13
128 0.16
129 0.18
130 0.23
131 0.31
132 0.38
133 0.46
134 0.55
135 0.6
136 0.67
137 0.74
138 0.77
139 0.77
140 0.78
141 0.74
142 0.73
143 0.73
144 0.72
145 0.69
146 0.71
147 0.73
148 0.74
149 0.78
150 0.81
151 0.82
152 0.83
153 0.87
154 0.87
155 0.88
156 0.88
157 0.88
158 0.88
159 0.87
160 0.86
161 0.86
162 0.85
163 0.85
164 0.83
165 0.81
166 0.81
167 0.75
168 0.66
169 0.57
170 0.55
171 0.52
172 0.45
173 0.4
174 0.39
175 0.42
176 0.49
177 0.56
178 0.58
179 0.61