Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4USM1

Protein Details
Accession E4USM1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-90GVSHRYPKGKRQKAKGGTAGLHydrophilic
NLS Segment(s)
PositionSequence
77-83KGKRQKA
Subcellular Location(s) mito 9, cyto 5.5, cyto_nucl 5.5, nucl 4.5, plas 3, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSSEMTDSPSATCRESACLIDARGMSDQRALAAVLLSRSPWVCVCLVLGLRGHRLYLALGRLVCRISIYGVSHRYPKGKRQKAKGGTAGLTSQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.2
5 0.22
6 0.2
7 0.22
8 0.21
9 0.19
10 0.2
11 0.19
12 0.17
13 0.16
14 0.15
15 0.12
16 0.12
17 0.1
18 0.08
19 0.08
20 0.08
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.08
29 0.07
30 0.07
31 0.08
32 0.08
33 0.08
34 0.09
35 0.1
36 0.09
37 0.1
38 0.1
39 0.1
40 0.08
41 0.09
42 0.08
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.12
49 0.12
50 0.11
51 0.1
52 0.09
53 0.08
54 0.11
55 0.13
56 0.17
57 0.21
58 0.23
59 0.27
60 0.3
61 0.36
62 0.37
63 0.45
64 0.5
65 0.57
66 0.64
67 0.69
68 0.77
69 0.78
70 0.84
71 0.81
72 0.75
73 0.67
74 0.61
75 0.54