Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166JGB6

Protein Details
Accession A0A166JGB6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36WKLSATRKANQRHRLKKVDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MRPSCINLGGLLWKVPWKLSATRKANQRHRLKKVDAVIEAVRSSGVECHALTRALELPKEHEMPARDKYTVFSPTTPGYRKGVHKVPKFTRLTLRTNPKGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.24
6 0.32
7 0.42
8 0.45
9 0.5
10 0.58
11 0.66
12 0.72
13 0.74
14 0.76
15 0.76
16 0.79
17 0.81
18 0.76
19 0.73
20 0.69
21 0.64
22 0.54
23 0.47
24 0.39
25 0.32
26 0.28
27 0.22
28 0.16
29 0.1
30 0.1
31 0.06
32 0.06
33 0.06
34 0.06
35 0.08
36 0.09
37 0.09
38 0.08
39 0.09
40 0.12
41 0.11
42 0.12
43 0.12
44 0.14
45 0.17
46 0.19
47 0.18
48 0.18
49 0.19
50 0.22
51 0.27
52 0.27
53 0.24
54 0.23
55 0.24
56 0.25
57 0.27
58 0.25
59 0.21
60 0.21
61 0.24
62 0.3
63 0.31
64 0.3
65 0.28
66 0.32
67 0.37
68 0.41
69 0.47
70 0.51
71 0.56
72 0.63
73 0.67
74 0.71
75 0.7
76 0.67
77 0.68
78 0.64
79 0.64
80 0.64
81 0.68