Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166IGF9

Protein Details
Accession A0A166IGF9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
23-43TLSGRRARKKPAKGNVKRDVNHydrophilic
NLS Segment(s)
PositionSequence
27-37RRARKKPAKGN
Subcellular Location(s) extr 13, cyto_mito 5, mito 4.5, cyto 4.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MGGSIRYVHFVFASLISAARDLTLSGRRARKKPAKGNVKRDVNVNQVDNDFLSLLSHYCISVHSRAQGQPQERWCQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.1
5 0.09
6 0.08
7 0.07
8 0.06
9 0.09
10 0.13
11 0.15
12 0.21
13 0.29
14 0.35
15 0.38
16 0.48
17 0.54
18 0.59
19 0.66
20 0.7
21 0.74
22 0.77
23 0.84
24 0.83
25 0.8
26 0.71
27 0.65
28 0.59
29 0.53
30 0.47
31 0.38
32 0.3
33 0.24
34 0.23
35 0.2
36 0.16
37 0.11
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.07
44 0.06
45 0.06
46 0.08
47 0.11
48 0.14
49 0.16
50 0.18
51 0.22
52 0.25
53 0.32
54 0.38
55 0.39
56 0.43
57 0.48