Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167TGY1

Protein Details
Accession A0A167TGY1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
220-241GGSKAAKQQKKEGKKGKKKPSABasic
NLS Segment(s)
PositionSequence
223-241KAAKQQKKEGKKGKKKPSA
Subcellular Location(s) cyto 11.5, cyto_nucl 10.333, nucl 8, mito_nucl 7.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MGDFLTKELGVQSAGLNKIENQAKGGAKWLVHLKLPGMGRMAELAEIKKLGHGIGIKAYVLPLVKTRSTIKVSVDGWPTWWTEDDAKSWIEGQSWCRKVTEPTRVAVEGTPVDKVTCLLHLPEEPVDIEQGKGADSSGDLYLIPDWKISASVRGHNVTVHRAPSCAFCGDDSHVVTNCELVQRCTSESMPLFKSIVPSSVTGTQMASDSSATVKGSGDDGGSKAAKQQKKEGKKGKKKPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.17
5 0.24
6 0.28
7 0.27
8 0.23
9 0.28
10 0.29
11 0.28
12 0.32
13 0.28
14 0.23
15 0.27
16 0.31
17 0.27
18 0.27
19 0.28
20 0.24
21 0.27
22 0.27
23 0.25
24 0.21
25 0.19
26 0.17
27 0.17
28 0.17
29 0.13
30 0.14
31 0.12
32 0.12
33 0.12
34 0.12
35 0.11
36 0.11
37 0.1
38 0.11
39 0.12
40 0.12
41 0.14
42 0.15
43 0.14
44 0.14
45 0.14
46 0.12
47 0.11
48 0.11
49 0.11
50 0.14
51 0.15
52 0.17
53 0.2
54 0.25
55 0.28
56 0.29
57 0.28
58 0.3
59 0.3
60 0.33
61 0.33
62 0.27
63 0.26
64 0.25
65 0.23
66 0.18
67 0.18
68 0.15
69 0.14
70 0.16
71 0.15
72 0.16
73 0.15
74 0.15
75 0.15
76 0.13
77 0.12
78 0.13
79 0.16
80 0.24
81 0.26
82 0.26
83 0.26
84 0.27
85 0.3
86 0.36
87 0.41
88 0.34
89 0.33
90 0.34
91 0.34
92 0.33
93 0.28
94 0.22
95 0.14
96 0.12
97 0.11
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.08
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.08
135 0.08
136 0.13
137 0.14
138 0.18
139 0.21
140 0.22
141 0.23
142 0.23
143 0.24
144 0.24
145 0.24
146 0.23
147 0.2
148 0.19
149 0.19
150 0.2
151 0.21
152 0.17
153 0.15
154 0.13
155 0.15
156 0.17
157 0.19
158 0.18
159 0.18
160 0.18
161 0.18
162 0.18
163 0.16
164 0.14
165 0.16
166 0.15
167 0.15
168 0.16
169 0.17
170 0.19
171 0.21
172 0.2
173 0.21
174 0.23
175 0.25
176 0.25
177 0.25
178 0.25
179 0.22
180 0.26
181 0.21
182 0.22
183 0.18
184 0.18
185 0.19
186 0.22
187 0.23
188 0.19
189 0.19
190 0.17
191 0.16
192 0.15
193 0.12
194 0.08
195 0.08
196 0.08
197 0.1
198 0.1
199 0.1
200 0.1
201 0.1
202 0.11
203 0.11
204 0.11
205 0.1
206 0.11
207 0.15
208 0.15
209 0.14
210 0.2
211 0.28
212 0.32
213 0.35
214 0.45
215 0.51
216 0.61
217 0.72
218 0.76
219 0.79
220 0.85
221 0.92