Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166VCY8

Protein Details
Accession A0A166VCY8   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
214-235TANTSKKGKGKKQGANSAKRAQHydrophilic
NLS Segment(s)
PositionSequence
37-81KPGPAPGRVGSSSDSRKGKMGKGKAKGSAPKKEVPKTKQNIKKLV
219-228KKGKGKKQGA
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDSSKKRKLTVDDEERVQKSKGNDGQTIEQATRPSGKPGPAPGRVGSSSDSRKGKMGKGKAKGSAPKKEVPKTKQNIKKLVPPRPFPTVPTSESATGPRSSHKEGKNYICITRKTPLAAYLRRCEDIVLTDGYKSLHLSAMGAAIPHLAMLAVSLPPILPFPADEIHTEILTGSVDVLDEVIPQDEDEDITYQTRSKSTLSVVIKIGSGEQEETANTSKKGKGKKQGANSAKRAQPDSGAQGDTSRGDKIIIQEPEQVDMDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.61
4 0.52
5 0.45
6 0.38
7 0.42
8 0.42
9 0.4
10 0.42
11 0.43
12 0.47
13 0.48
14 0.48
15 0.39
16 0.35
17 0.3
18 0.28
19 0.29
20 0.25
21 0.27
22 0.28
23 0.3
24 0.31
25 0.4
26 0.45
27 0.44
28 0.47
29 0.42
30 0.44
31 0.41
32 0.4
33 0.32
34 0.32
35 0.32
36 0.36
37 0.38
38 0.33
39 0.37
40 0.39
41 0.43
42 0.45
43 0.5
44 0.51
45 0.57
46 0.6
47 0.61
48 0.65
49 0.67
50 0.65
51 0.65
52 0.61
53 0.6
54 0.63
55 0.65
56 0.68
57 0.66
58 0.68
59 0.67
60 0.73
61 0.75
62 0.75
63 0.76
64 0.7
65 0.73
66 0.71
67 0.73
68 0.7
69 0.67
70 0.63
71 0.62
72 0.59
73 0.52
74 0.5
75 0.44
76 0.39
77 0.36
78 0.34
79 0.28
80 0.28
81 0.28
82 0.24
83 0.21
84 0.19
85 0.2
86 0.22
87 0.25
88 0.32
89 0.34
90 0.38
91 0.42
92 0.47
93 0.51
94 0.49
95 0.49
96 0.48
97 0.45
98 0.41
99 0.38
100 0.34
101 0.28
102 0.26
103 0.27
104 0.28
105 0.31
106 0.33
107 0.34
108 0.35
109 0.35
110 0.34
111 0.28
112 0.22
113 0.18
114 0.16
115 0.12
116 0.1
117 0.09
118 0.1
119 0.1
120 0.09
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.04
134 0.03
135 0.02
136 0.02
137 0.02
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.06
149 0.07
150 0.09
151 0.09
152 0.12
153 0.12
154 0.12
155 0.12
156 0.1
157 0.09
158 0.08
159 0.07
160 0.04
161 0.03
162 0.03
163 0.03
164 0.04
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.06
175 0.07
176 0.07
177 0.08
178 0.09
179 0.1
180 0.11
181 0.12
182 0.13
183 0.13
184 0.14
185 0.15
186 0.23
187 0.24
188 0.26
189 0.27
190 0.26
191 0.25
192 0.23
193 0.22
194 0.14
195 0.13
196 0.1
197 0.1
198 0.09
199 0.09
200 0.12
201 0.15
202 0.16
203 0.16
204 0.19
205 0.24
206 0.29
207 0.39
208 0.44
209 0.51
210 0.59
211 0.67
212 0.73
213 0.79
214 0.83
215 0.83
216 0.82
217 0.8
218 0.73
219 0.69
220 0.62
221 0.52
222 0.47
223 0.42
224 0.4
225 0.35
226 0.33
227 0.29
228 0.27
229 0.27
230 0.25
231 0.22
232 0.17
233 0.14
234 0.14
235 0.16
236 0.19
237 0.26
238 0.27
239 0.28
240 0.33
241 0.34
242 0.37
243 0.35