Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166FTT6

Protein Details
Accession A0A166FTT6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
326-352WTAGGRRYWLRMRRRSRELFTARRRLAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011042  6-blade_b-propeller_TolB-like  
Amino Acid Sequences MTTGVPVRGIPTRSNINLFVLVFHSWLPLSSRPQSVGGPPETRANDDVTANPVDDRNPITTTGTTPKSQPSLPPNRTCWPPHDSCSISAPPSATPDGQDIRILSTLADGVVVDTRHGKGRIYVTCMGYFVSTNDGRLVRAAGDGTGVEVIVPDGATFTPKQLVIDMASEKLCWADREGMRTDEDRKDSTRTCVGVSVDTTELSSFIYVWWGASKAHQGRILRANIDIPPNQTIQTLYAHLPEPIDLDLDPASQTLYWTDRGDPPLGNTLNRADVSAHLAPTAGAKGPGRDTVVVGKLHEAIALSLDLPGRRALVADLNGPCMRWIWTAGGRRYWLRMRRRSRELFTARRRLAWSVIWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.35
4 0.36
5 0.34
6 0.29
7 0.24
8 0.22
9 0.18
10 0.17
11 0.15
12 0.11
13 0.12
14 0.15
15 0.17
16 0.23
17 0.27
18 0.3
19 0.31
20 0.34
21 0.35
22 0.35
23 0.37
24 0.37
25 0.34
26 0.33
27 0.38
28 0.37
29 0.38
30 0.35
31 0.31
32 0.28
33 0.27
34 0.27
35 0.23
36 0.23
37 0.2
38 0.19
39 0.17
40 0.16
41 0.17
42 0.18
43 0.17
44 0.17
45 0.18
46 0.2
47 0.2
48 0.23
49 0.28
50 0.29
51 0.27
52 0.27
53 0.31
54 0.31
55 0.32
56 0.35
57 0.38
58 0.45
59 0.52
60 0.57
61 0.58
62 0.6
63 0.64
64 0.6
65 0.55
66 0.51
67 0.48
68 0.45
69 0.47
70 0.44
71 0.4
72 0.43
73 0.4
74 0.34
75 0.3
76 0.28
77 0.21
78 0.22
79 0.23
80 0.17
81 0.16
82 0.19
83 0.19
84 0.19
85 0.2
86 0.17
87 0.16
88 0.17
89 0.16
90 0.11
91 0.09
92 0.09
93 0.07
94 0.07
95 0.05
96 0.05
97 0.07
98 0.07
99 0.07
100 0.08
101 0.1
102 0.14
103 0.14
104 0.14
105 0.16
106 0.23
107 0.25
108 0.29
109 0.32
110 0.3
111 0.3
112 0.3
113 0.26
114 0.2
115 0.18
116 0.12
117 0.14
118 0.12
119 0.12
120 0.14
121 0.14
122 0.14
123 0.14
124 0.14
125 0.09
126 0.09
127 0.09
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.02
140 0.03
141 0.03
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.08
148 0.08
149 0.09
150 0.08
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.09
159 0.07
160 0.08
161 0.14
162 0.15
163 0.18
164 0.2
165 0.21
166 0.21
167 0.23
168 0.25
169 0.22
170 0.24
171 0.22
172 0.22
173 0.24
174 0.24
175 0.26
176 0.26
177 0.23
178 0.21
179 0.22
180 0.2
181 0.18
182 0.17
183 0.15
184 0.12
185 0.11
186 0.11
187 0.08
188 0.07
189 0.06
190 0.06
191 0.04
192 0.04
193 0.05
194 0.04
195 0.05
196 0.05
197 0.06
198 0.06
199 0.07
200 0.15
201 0.16
202 0.2
203 0.24
204 0.24
205 0.28
206 0.34
207 0.35
208 0.28
209 0.27
210 0.25
211 0.23
212 0.26
213 0.23
214 0.19
215 0.19
216 0.19
217 0.19
218 0.17
219 0.16
220 0.13
221 0.14
222 0.14
223 0.12
224 0.13
225 0.13
226 0.13
227 0.13
228 0.12
229 0.11
230 0.09
231 0.09
232 0.07
233 0.08
234 0.08
235 0.08
236 0.08
237 0.07
238 0.07
239 0.06
240 0.07
241 0.07
242 0.09
243 0.11
244 0.12
245 0.15
246 0.18
247 0.21
248 0.23
249 0.21
250 0.22
251 0.27
252 0.27
253 0.25
254 0.23
255 0.22
256 0.24
257 0.23
258 0.22
259 0.14
260 0.14
261 0.2
262 0.2
263 0.19
264 0.15
265 0.15
266 0.14
267 0.15
268 0.15
269 0.09
270 0.1
271 0.1
272 0.13
273 0.15
274 0.17
275 0.18
276 0.18
277 0.19
278 0.21
279 0.25
280 0.24
281 0.22
282 0.21
283 0.2
284 0.2
285 0.19
286 0.14
287 0.09
288 0.1
289 0.09
290 0.08
291 0.08
292 0.1
293 0.1
294 0.1
295 0.11
296 0.11
297 0.1
298 0.11
299 0.11
300 0.14
301 0.16
302 0.21
303 0.21
304 0.26
305 0.26
306 0.26
307 0.24
308 0.2
309 0.21
310 0.16
311 0.18
312 0.18
313 0.25
314 0.34
315 0.38
316 0.42
317 0.44
318 0.45
319 0.49
320 0.53
321 0.54
322 0.56
323 0.62
324 0.68
325 0.74
326 0.82
327 0.84
328 0.81
329 0.84
330 0.83
331 0.83
332 0.83
333 0.84
334 0.76
335 0.73
336 0.7
337 0.62
338 0.56