Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166TL10

Protein Details
Accession A0A166TL10    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-69SFARGLPSKKRPKKGLCPIHTHydrophilic
NLS Segment(s)
PositionSequence
57-62KKRPKK
Subcellular Location(s) mito 7, cysk 7, plas 5, cyto_nucl 3, E.R. 3, nucl 2, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLPAGNPVLFIFLIIEDCVSLFEIVAQMLLAWVGGPGRLLLCPILIASFARGLPSKKRPKKGLCPIHTCTLVAKFWSMSDPAGVHKIVNLVIVRPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.06
12 0.05
13 0.05
14 0.05
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.06
39 0.08
40 0.09
41 0.15
42 0.26
43 0.36
44 0.43
45 0.51
46 0.59
47 0.67
48 0.76
49 0.8
50 0.81
51 0.78
52 0.78
53 0.74
54 0.71
55 0.63
56 0.53
57 0.44
58 0.37
59 0.3
60 0.23
61 0.2
62 0.15
63 0.14
64 0.16
65 0.15
66 0.11
67 0.12
68 0.12
69 0.14
70 0.16
71 0.16
72 0.14
73 0.14
74 0.15
75 0.14
76 0.17
77 0.15