Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166CKC1

Protein Details
Accession A0A166CKC1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-97SSSLTCAVRKRRPPSKRYVLGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
Amino Acid Sequences MNITLREVYQTNSDGDRFWKLKECYIRGSTIKYLRVPDTLLDTVKEEQARARESGRGGRGGSGPRGKQPADLWQSSSSLTCAVRKRRPPSKRYVLGVSRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.27
4 0.24
5 0.24
6 0.31
7 0.3
8 0.37
9 0.44
10 0.45
11 0.44
12 0.45
13 0.48
14 0.41
15 0.44
16 0.43
17 0.39
18 0.4
19 0.35
20 0.36
21 0.32
22 0.32
23 0.28
24 0.23
25 0.23
26 0.21
27 0.19
28 0.16
29 0.16
30 0.16
31 0.18
32 0.17
33 0.12
34 0.12
35 0.15
36 0.16
37 0.15
38 0.15
39 0.15
40 0.16
41 0.21
42 0.21
43 0.2
44 0.18
45 0.19
46 0.21
47 0.2
48 0.24
49 0.25
50 0.24
51 0.26
52 0.29
53 0.28
54 0.28
55 0.28
56 0.32
57 0.33
58 0.33
59 0.32
60 0.3
61 0.3
62 0.28
63 0.27
64 0.18
65 0.15
66 0.16
67 0.18
68 0.25
69 0.33
70 0.42
71 0.5
72 0.6
73 0.67
74 0.76
75 0.77
76 0.8
77 0.82
78 0.81
79 0.78
80 0.78