Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166KE32

Protein Details
Accession A0A166KE32    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ITPKRRLRMSCPPRKPHLKPBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MIWEWLVGKDYYCITPKRRLRMSCPPRKPHLKPGIIILTRHQTSLVHTPLLEIESLIRLVWGLKLSQLWKSPIVLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.37
3 0.43
4 0.5
5 0.57
6 0.58
7 0.61
8 0.68
9 0.74
10 0.75
11 0.78
12 0.76
13 0.76
14 0.81
15 0.78
16 0.77
17 0.76
18 0.69
19 0.6
20 0.58
21 0.58
22 0.5
23 0.45
24 0.36
25 0.32
26 0.29
27 0.28
28 0.23
29 0.14
30 0.16
31 0.22
32 0.22
33 0.16
34 0.16
35 0.16
36 0.16
37 0.17
38 0.13
39 0.07
40 0.06
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.07
48 0.08
49 0.07
50 0.08
51 0.12
52 0.14
53 0.2
54 0.24
55 0.25
56 0.26