Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Z7A5

Protein Details
Accession A0A165Z7A5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
182-213KTGNLNRTCNQKRKRGRRNRRHLLNVRRANGIHydrophilic
NLS Segment(s)
PositionSequence
193-203KRKRGRRNRRH
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVASIESRRPGGRQKAIVRQLSGDRAGHGRLRHRDLASNSTTVLTEDRSRTIQLCDKIPKKGSRLTGLIQSIPTSRMRPSREPRAVRLQYILHFCHVQNLDSTSDIQVFCGVGSKEGYVARMSNGDKEDHPSLREPNRHANEESRELSACAHVATFIRAANCELLDSSGFSSSVMFKKLDSKTGNLNRTCNQKRKRGRRNRRHLLNVRRANGINQDRWRMNNPGSCDCEERRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.72
4 0.73
5 0.65
6 0.6
7 0.56
8 0.52
9 0.48
10 0.38
11 0.31
12 0.29
13 0.3
14 0.3
15 0.3
16 0.34
17 0.38
18 0.44
19 0.49
20 0.48
21 0.53
22 0.53
23 0.56
24 0.5
25 0.43
26 0.37
27 0.31
28 0.29
29 0.22
30 0.19
31 0.15
32 0.16
33 0.17
34 0.19
35 0.2
36 0.21
37 0.22
38 0.26
39 0.3
40 0.29
41 0.33
42 0.4
43 0.42
44 0.47
45 0.53
46 0.53
47 0.51
48 0.54
49 0.52
50 0.48
51 0.48
52 0.43
53 0.43
54 0.4
55 0.36
56 0.3
57 0.26
58 0.22
59 0.2
60 0.2
61 0.15
62 0.17
63 0.23
64 0.28
65 0.36
66 0.43
67 0.51
68 0.59
69 0.61
70 0.62
71 0.67
72 0.63
73 0.55
74 0.5
75 0.42
76 0.36
77 0.37
78 0.32
79 0.23
80 0.23
81 0.21
82 0.25
83 0.23
84 0.2
85 0.16
86 0.17
87 0.17
88 0.16
89 0.16
90 0.1
91 0.12
92 0.11
93 0.1
94 0.08
95 0.08
96 0.07
97 0.09
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.09
104 0.1
105 0.08
106 0.08
107 0.08
108 0.11
109 0.11
110 0.13
111 0.14
112 0.14
113 0.14
114 0.18
115 0.21
116 0.18
117 0.19
118 0.19
119 0.23
120 0.28
121 0.33
122 0.32
123 0.39
124 0.42
125 0.44
126 0.43
127 0.43
128 0.41
129 0.42
130 0.4
131 0.31
132 0.27
133 0.24
134 0.23
135 0.18
136 0.14
137 0.09
138 0.07
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.09
145 0.09
146 0.1
147 0.11
148 0.1
149 0.09
150 0.09
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.11
160 0.13
161 0.14
162 0.13
163 0.13
164 0.22
165 0.23
166 0.3
167 0.29
168 0.3
169 0.38
170 0.47
171 0.54
172 0.49
173 0.52
174 0.49
175 0.58
176 0.64
177 0.63
178 0.62
179 0.65
180 0.72
181 0.79
182 0.86
183 0.87
184 0.9
185 0.91
186 0.95
187 0.96
188 0.95
189 0.95
190 0.94
191 0.93
192 0.93
193 0.91
194 0.82
195 0.77
196 0.67
197 0.6
198 0.59
199 0.55
200 0.53
201 0.5
202 0.55
203 0.52
204 0.55
205 0.57
206 0.53
207 0.52
208 0.5
209 0.5
210 0.5
211 0.53
212 0.52
213 0.53