Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ACU0

Protein Details
Accession A0A166ACU0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-40ALPPIWRSREIKKKRTFRTFSYRGHydrophilic
NLS Segment(s)
PositionSequence
58-88RARRRFGRGLKRKPMGLIKKLRTAKKEAPPN
Subcellular Location(s) cyto 12, cyto_nucl 9.5, mito 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences MPTAARTFLTSAAEGEALPPIWRSREIKKKRTFRTFSYRGVALEQLLDLSNEDLVHARARRRFGRGLKRKPMGLIKKLRTAKKEAPPNEKPAVVKTHLRDMIVVPEMIGSVVGIYNGKVFNSVEIKPEMTGHYLAEFSCSYRPVKHGRPASRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.1
5 0.1
6 0.1
7 0.11
8 0.13
9 0.18
10 0.21
11 0.29
12 0.4
13 0.5
14 0.59
15 0.67
16 0.75
17 0.81
18 0.88
19 0.83
20 0.8
21 0.81
22 0.77
23 0.73
24 0.67
25 0.58
26 0.48
27 0.44
28 0.37
29 0.27
30 0.2
31 0.14
32 0.1
33 0.09
34 0.08
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.1
43 0.12
44 0.16
45 0.19
46 0.25
47 0.28
48 0.32
49 0.38
50 0.44
51 0.53
52 0.59
53 0.65
54 0.69
55 0.69
56 0.65
57 0.61
58 0.62
59 0.57
60 0.55
61 0.54
62 0.48
63 0.54
64 0.59
65 0.59
66 0.53
67 0.53
68 0.53
69 0.51
70 0.57
71 0.55
72 0.58
73 0.58
74 0.61
75 0.56
76 0.5
77 0.43
78 0.37
79 0.35
80 0.29
81 0.3
82 0.26
83 0.32
84 0.31
85 0.31
86 0.28
87 0.24
88 0.25
89 0.22
90 0.2
91 0.12
92 0.1
93 0.1
94 0.09
95 0.08
96 0.04
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.06
103 0.06
104 0.06
105 0.08
106 0.08
107 0.11
108 0.15
109 0.16
110 0.17
111 0.18
112 0.19
113 0.18
114 0.2
115 0.18
116 0.17
117 0.17
118 0.14
119 0.14
120 0.13
121 0.13
122 0.15
123 0.13
124 0.13
125 0.14
126 0.16
127 0.17
128 0.19
129 0.25
130 0.3
131 0.38
132 0.46
133 0.53
134 0.61
135 0.66
136 0.69
137 0.67