Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R1Z9

Protein Details
Accession E5R1Z9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-80AEPEKVDKKEEKKEEKKEEKKEEEKEEKAcidic
NLS Segment(s)
PositionSequence
6-89RKRKAPVPAPVAEPKAKRGAKAGAKAEPKKAAPKGEKKAAAAAAAPAAEPEKVDKKEEKKEEKKEEKKEEEKEEKKEEKKEAKG
Subcellular Location(s) mito 15, nucl 8, cyto_nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MAPELRKRKAPVPAPVAEPKAKRGAKAGAKAEPKKAAPKGEKKAAAAAAAPAAEPEKVDKKEEKKEEKKEEKKEEEKEEKKEEKKEAKGEEAEDKPASRVPEEGDVLDLSLFEDEIELNDGTKTSFKKLLEESKEGVAVFTYPKASTPGCTRQACAFRDDYTNLTSTGLSIFGLSGDSPKANTTFQTKQKLPYPLLCDPSFKLIGAFGLKKTPKGTVRGVFAVNKEGKVLLRTPGGPEKTLSLVQDLVKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.63
4 0.6
5 0.53
6 0.48
7 0.51
8 0.48
9 0.43
10 0.42
11 0.46
12 0.47
13 0.54
14 0.55
15 0.53
16 0.61
17 0.63
18 0.64
19 0.61
20 0.56
21 0.56
22 0.56
23 0.57
24 0.57
25 0.64
26 0.66
27 0.69
28 0.7
29 0.63
30 0.63
31 0.55
32 0.46
33 0.36
34 0.28
35 0.2
36 0.16
37 0.15
38 0.1
39 0.09
40 0.08
41 0.07
42 0.11
43 0.17
44 0.19
45 0.23
46 0.3
47 0.36
48 0.46
49 0.56
50 0.62
51 0.65
52 0.73
53 0.8
54 0.84
55 0.87
56 0.87
57 0.88
58 0.86
59 0.84
60 0.82
61 0.8
62 0.8
63 0.77
64 0.73
65 0.72
66 0.71
67 0.69
68 0.68
69 0.67
70 0.65
71 0.65
72 0.65
73 0.59
74 0.56
75 0.52
76 0.48
77 0.46
78 0.39
79 0.36
80 0.29
81 0.26
82 0.22
83 0.22
84 0.21
85 0.14
86 0.14
87 0.12
88 0.15
89 0.16
90 0.15
91 0.13
92 0.12
93 0.12
94 0.11
95 0.09
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.09
110 0.09
111 0.09
112 0.14
113 0.14
114 0.17
115 0.21
116 0.29
117 0.31
118 0.33
119 0.32
120 0.29
121 0.3
122 0.26
123 0.23
124 0.14
125 0.1
126 0.08
127 0.07
128 0.07
129 0.06
130 0.07
131 0.1
132 0.1
133 0.11
134 0.17
135 0.24
136 0.3
137 0.31
138 0.32
139 0.35
140 0.42
141 0.41
142 0.38
143 0.32
144 0.26
145 0.29
146 0.29
147 0.25
148 0.2
149 0.2
150 0.17
151 0.16
152 0.14
153 0.11
154 0.1
155 0.08
156 0.06
157 0.06
158 0.05
159 0.04
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.08
167 0.1
168 0.1
169 0.12
170 0.18
171 0.25
172 0.32
173 0.4
174 0.41
175 0.45
176 0.51
177 0.56
178 0.52
179 0.51
180 0.51
181 0.48
182 0.52
183 0.47
184 0.43
185 0.38
186 0.4
187 0.35
188 0.27
189 0.22
190 0.16
191 0.18
192 0.2
193 0.2
194 0.16
195 0.23
196 0.24
197 0.27
198 0.28
199 0.33
200 0.33
201 0.37
202 0.44
203 0.41
204 0.45
205 0.46
206 0.48
207 0.44
208 0.41
209 0.43
210 0.38
211 0.33
212 0.28
213 0.26
214 0.24
215 0.24
216 0.25
217 0.2
218 0.22
219 0.23
220 0.28
221 0.35
222 0.37
223 0.35
224 0.34
225 0.33
226 0.33
227 0.34
228 0.29
229 0.23
230 0.24
231 0.23