Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166QXK5

Protein Details
Accession A0A166QXK5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-65GARCKGCKKSQVKKDAKRRVAEBasic
NLS Segment(s)
PositionSequence
56-57KK
Subcellular Location(s) nucl 15.5, cyto 10, mito_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLSCNTDHPNSKLAGKQKGMKAVLQERVSVLDESVRRRGGKVQGARCKGCKKSQVKKDAKRRVAEVEAVGREDEIMEEDLADVDSVTEEAGFRSLNDNKFPAAKLLVPQCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.48
4 0.49
5 0.55
6 0.53
7 0.49
8 0.49
9 0.48
10 0.5
11 0.44
12 0.4
13 0.32
14 0.33
15 0.33
16 0.26
17 0.19
18 0.16
19 0.17
20 0.2
21 0.24
22 0.25
23 0.23
24 0.24
25 0.29
26 0.31
27 0.36
28 0.41
29 0.46
30 0.51
31 0.56
32 0.58
33 0.58
34 0.57
35 0.53
36 0.51
37 0.51
38 0.52
39 0.56
40 0.63
41 0.69
42 0.73
43 0.78
44 0.83
45 0.84
46 0.81
47 0.74
48 0.68
49 0.62
50 0.54
51 0.46
52 0.37
53 0.31
54 0.25
55 0.23
56 0.2
57 0.15
58 0.12
59 0.11
60 0.09
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.06
80 0.12
81 0.18
82 0.21
83 0.25
84 0.26
85 0.27
86 0.3
87 0.3
88 0.27
89 0.24
90 0.23
91 0.26