Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166NM43

Protein Details
Accession A0A166NM43    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-86IGSKTKSTRSRSKHRMPPLITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, plas 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MLATCIAVCFGARCTFKIRGTRSSVLHPPSWRSFQIYRLPPSTTILTPLQAPFPTCLKSRAILLSIGSKTKSTRSRSKHRMPPLITTPCTSASASLPRTFSFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.35
4 0.43
5 0.45
6 0.45
7 0.52
8 0.55
9 0.52
10 0.53
11 0.54
12 0.49
13 0.49
14 0.44
15 0.42
16 0.41
17 0.43
18 0.37
19 0.36
20 0.34
21 0.36
22 0.42
23 0.42
24 0.42
25 0.4
26 0.41
27 0.35
28 0.37
29 0.33
30 0.24
31 0.22
32 0.18
33 0.16
34 0.16
35 0.16
36 0.14
37 0.12
38 0.13
39 0.11
40 0.12
41 0.13
42 0.13
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.16
49 0.14
50 0.14
51 0.17
52 0.17
53 0.18
54 0.17
55 0.16
56 0.16
57 0.23
58 0.3
59 0.31
60 0.4
61 0.47
62 0.57
63 0.67
64 0.76
65 0.78
66 0.8
67 0.83
68 0.77
69 0.76
70 0.75
71 0.73
72 0.64
73 0.57
74 0.49
75 0.42
76 0.41
77 0.33
78 0.26
79 0.22
80 0.28
81 0.3
82 0.31
83 0.31