Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166N7T9

Protein Details
Accession A0A166N7T9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-76ALNREKARESRKKVEKNWADFNAHydrophilic
NLS Segment(s)
PositionSequence
59-65KARESRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLTDKKLVCKDFIQALEACHAKGWTRFTGACNDAKTDLNHCLHSETVKRAALNREKARESRKKVEKNWADFNADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.34
4 0.27
5 0.26
6 0.27
7 0.26
8 0.22
9 0.16
10 0.16
11 0.14
12 0.16
13 0.19
14 0.16
15 0.18
16 0.2
17 0.2
18 0.26
19 0.27
20 0.27
21 0.24
22 0.23
23 0.22
24 0.22
25 0.22
26 0.18
27 0.21
28 0.19
29 0.19
30 0.18
31 0.18
32 0.17
33 0.18
34 0.19
35 0.17
36 0.2
37 0.21
38 0.21
39 0.23
40 0.32
41 0.37
42 0.44
43 0.48
44 0.49
45 0.52
46 0.57
47 0.64
48 0.65
49 0.66
50 0.67
51 0.7
52 0.74
53 0.77
54 0.82
55 0.82
56 0.79
57 0.8
58 0.74