Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MIW2

Protein Details
Accession A0A166MIW2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-37NLTVRKPTHENNRPHKRAKREESPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MPSPPQSPTYLANLTVRKPTHENNRPHKRAKREESPVPASPSQLTRTLIPKADTAADIDEDEDEVKDIADDKINKEEDANEDGDEQDEDEEQCSICLQPLVDRTVIPTCAHEFCLDRGGGEAGSRCTRARDREAEMGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.36
4 0.34
5 0.37
6 0.43
7 0.47
8 0.53
9 0.61
10 0.65
11 0.75
12 0.78
13 0.82
14 0.83
15 0.82
16 0.84
17 0.82
18 0.81
19 0.78
20 0.79
21 0.78
22 0.76
23 0.7
24 0.65
25 0.56
26 0.48
27 0.41
28 0.36
29 0.3
30 0.27
31 0.24
32 0.21
33 0.24
34 0.25
35 0.26
36 0.24
37 0.22
38 0.2
39 0.19
40 0.17
41 0.14
42 0.12
43 0.1
44 0.09
45 0.09
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.08
57 0.09
58 0.1
59 0.15
60 0.16
61 0.16
62 0.15
63 0.16
64 0.16
65 0.18
66 0.17
67 0.12
68 0.12
69 0.12
70 0.12
71 0.11
72 0.08
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.09
86 0.12
87 0.14
88 0.14
89 0.14
90 0.17
91 0.19
92 0.2
93 0.18
94 0.17
95 0.18
96 0.19
97 0.2
98 0.19
99 0.18
100 0.18
101 0.22
102 0.2
103 0.17
104 0.17
105 0.17
106 0.15
107 0.15
108 0.15
109 0.15
110 0.18
111 0.2
112 0.19
113 0.24
114 0.3
115 0.36
116 0.42
117 0.44
118 0.48