Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166DFT9

Protein Details
Accession A0A166DFT9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
200-224QSSKRPPPCHSPCQLQKRRCVRVLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.833, cyto_mito 5.166, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039772  Bin3-like  
IPR010675  Bin3_C  
IPR024160  BIN3_SAM-bd_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008171  F:O-methyltransferase activity  
GO:0008173  F:RNA methyltransferase activity  
Pfam View protein in Pfam  
PF06859  Bin3  
PROSITE View protein in PROSITE  
PS51515  BIN3_SAM  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPVVPIHGNYYGYYLKRPFTADPRLSLLSDDLFAGRRVLDVGCNEGWVTCEIAQSWGASHVLGVDIDEVLIRGSWRRRCVAWSLQAPDSHPSHLASDSEEHPSKCAREETPIVPNHFPASFEHTYGPMSVPPYENTSKHIFPHNVSFRTADWVNEDVPEDQSGYDVVIAFSISKWIHLNGGDNVMVRFFKRVHDVLSVSQSSKRPPPCHSPCQLQKRRCVRVLRVASGGVPII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.32
5 0.33
6 0.36
7 0.45
8 0.43
9 0.43
10 0.47
11 0.47
12 0.43
13 0.39
14 0.33
15 0.23
16 0.2
17 0.17
18 0.13
19 0.12
20 0.12
21 0.11
22 0.1
23 0.09
24 0.1
25 0.1
26 0.12
27 0.11
28 0.15
29 0.15
30 0.15
31 0.15
32 0.14
33 0.15
34 0.12
35 0.14
36 0.1
37 0.11
38 0.1
39 0.12
40 0.12
41 0.11
42 0.11
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.08
60 0.14
61 0.19
62 0.23
63 0.25
64 0.26
65 0.29
66 0.35
67 0.38
68 0.4
69 0.41
70 0.42
71 0.42
72 0.42
73 0.4
74 0.38
75 0.32
76 0.25
77 0.2
78 0.16
79 0.15
80 0.15
81 0.14
82 0.12
83 0.13
84 0.13
85 0.18
86 0.19
87 0.18
88 0.18
89 0.19
90 0.18
91 0.18
92 0.19
93 0.15
94 0.17
95 0.2
96 0.22
97 0.27
98 0.3
99 0.31
100 0.29
101 0.28
102 0.25
103 0.22
104 0.2
105 0.14
106 0.19
107 0.16
108 0.17
109 0.17
110 0.16
111 0.17
112 0.16
113 0.16
114 0.09
115 0.1
116 0.1
117 0.1
118 0.11
119 0.16
120 0.18
121 0.18
122 0.2
123 0.23
124 0.23
125 0.24
126 0.29
127 0.26
128 0.25
129 0.35
130 0.38
131 0.35
132 0.35
133 0.35
134 0.29
135 0.32
136 0.31
137 0.22
138 0.18
139 0.18
140 0.17
141 0.16
142 0.17
143 0.13
144 0.13
145 0.13
146 0.1
147 0.09
148 0.09
149 0.08
150 0.07
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.09
159 0.08
160 0.09
161 0.1
162 0.11
163 0.13
164 0.14
165 0.17
166 0.15
167 0.18
168 0.17
169 0.17
170 0.16
171 0.16
172 0.15
173 0.12
174 0.14
175 0.12
176 0.14
177 0.19
178 0.21
179 0.22
180 0.26
181 0.28
182 0.29
183 0.35
184 0.34
185 0.29
186 0.33
187 0.32
188 0.32
189 0.38
190 0.43
191 0.41
192 0.45
193 0.55
194 0.59
195 0.66
196 0.68
197 0.7
198 0.72
199 0.79
200 0.82
201 0.78
202 0.8
203 0.81
204 0.84
205 0.81
206 0.79
207 0.76
208 0.77
209 0.78
210 0.73
211 0.65
212 0.57
213 0.5