Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166KB62

Protein Details
Accession A0A166KB62    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-46SSSGGGKSAKKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
14-41AKAPPPSSSGGGKSAKKKKWSKGKVKDK
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MSWLCNCPSIMAKAKAPPPSSSGGGKSAKKKKWSKGKVKDKAQHAVVLDKPTYDRILKEVPTFKFISQSILIERLKVNGSLARVAIQHLAREGQIKPIVHHSSQLIYTRAIGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.47
4 0.43
5 0.38
6 0.39
7 0.39
8 0.35
9 0.32
10 0.32
11 0.35
12 0.39
13 0.45
14 0.5
15 0.54
16 0.6
17 0.66
18 0.69
19 0.74
20 0.8
21 0.82
22 0.83
23 0.88
24 0.88
25 0.9
26 0.88
27 0.82
28 0.78
29 0.69
30 0.61
31 0.5
32 0.44
33 0.36
34 0.32
35 0.26
36 0.19
37 0.18
38 0.16
39 0.18
40 0.14
41 0.12
42 0.12
43 0.15
44 0.16
45 0.19
46 0.24
47 0.23
48 0.26
49 0.27
50 0.24
51 0.24
52 0.23
53 0.23
54 0.18
55 0.18
56 0.16
57 0.2
58 0.2
59 0.18
60 0.18
61 0.16
62 0.16
63 0.15
64 0.15
65 0.12
66 0.13
67 0.13
68 0.13
69 0.13
70 0.12
71 0.13
72 0.16
73 0.15
74 0.14
75 0.14
76 0.15
77 0.14
78 0.17
79 0.16
80 0.19
81 0.23
82 0.23
83 0.24
84 0.31
85 0.36
86 0.33
87 0.35
88 0.3
89 0.29
90 0.32
91 0.35
92 0.28
93 0.24
94 0.25