Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UV39

Protein Details
Accession E4UV39    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
234-256TEVPRKQTRKPAASRRSKRKADEBasic
NLS Segment(s)
PositionSequence
238-254RKQTRKPAASRRSKRKA
318-325KKGGKSEK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR010585  DNA_repair_prot_XRCC4  
IPR014751  XRCC4-like_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF06632  XRCC4  
Amino Acid Sequences MSQDSILRIPRSDSSGDYALIKVSKSGTSDLDLQLVGTEGENPYIGSLRSNGIKKLRAKNYRGDDDEWIGVLSYCFDRMPESDTNAEWISGLEVLAAVQGDDNEENKELHITLRKRIDSITQKLGTVVLKQDDEQAIELFEWTGMAVSKAKTLGQQVSNLQTKYREAEETINKLKAQLEDFIETKNRHDEQLIGKFVGLLNEKKSKIRSQQRLITKAKENPDTVVQLEQEAATTEVPRKQTRKPAASRRSKRKADEPPPEESESDDGFDAMDIDKKDATADVDEGSSTTDERQDTPEPLEDETASEIDDEVPHAPAPKKGGKSEKGPKTTTAVTSGANRTRNTRALSARPEVTEPPPPRELPFGKKRAASKPAVESNEDGETDSEDDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.28
5 0.25
6 0.23
7 0.23
8 0.2
9 0.16
10 0.16
11 0.17
12 0.18
13 0.2
14 0.19
15 0.21
16 0.26
17 0.25
18 0.24
19 0.22
20 0.2
21 0.17
22 0.15
23 0.12
24 0.08
25 0.09
26 0.08
27 0.09
28 0.09
29 0.08
30 0.09
31 0.1
32 0.1
33 0.09
34 0.11
35 0.13
36 0.2
37 0.22
38 0.27
39 0.32
40 0.39
41 0.46
42 0.55
43 0.62
44 0.66
45 0.68
46 0.72
47 0.75
48 0.76
49 0.72
50 0.65
51 0.58
52 0.52
53 0.48
54 0.39
55 0.3
56 0.21
57 0.17
58 0.13
59 0.11
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.11
66 0.16
67 0.17
68 0.2
69 0.21
70 0.22
71 0.25
72 0.23
73 0.22
74 0.17
75 0.14
76 0.11
77 0.09
78 0.09
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.03
86 0.04
87 0.05
88 0.06
89 0.07
90 0.08
91 0.1
92 0.1
93 0.1
94 0.11
95 0.1
96 0.12
97 0.2
98 0.2
99 0.26
100 0.33
101 0.34
102 0.33
103 0.34
104 0.4
105 0.41
106 0.44
107 0.46
108 0.4
109 0.39
110 0.39
111 0.4
112 0.31
113 0.24
114 0.21
115 0.15
116 0.15
117 0.15
118 0.18
119 0.17
120 0.16
121 0.16
122 0.13
123 0.11
124 0.1
125 0.1
126 0.07
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.05
133 0.06
134 0.06
135 0.08
136 0.09
137 0.09
138 0.11
139 0.14
140 0.18
141 0.18
142 0.2
143 0.21
144 0.27
145 0.3
146 0.29
147 0.27
148 0.23
149 0.22
150 0.22
151 0.22
152 0.16
153 0.14
154 0.2
155 0.24
156 0.28
157 0.31
158 0.3
159 0.28
160 0.28
161 0.28
162 0.24
163 0.21
164 0.18
165 0.17
166 0.17
167 0.18
168 0.18
169 0.2
170 0.19
171 0.19
172 0.22
173 0.2
174 0.18
175 0.19
176 0.21
177 0.22
178 0.29
179 0.29
180 0.23
181 0.22
182 0.21
183 0.21
184 0.21
185 0.17
186 0.11
187 0.14
188 0.2
189 0.21
190 0.23
191 0.25
192 0.28
193 0.35
194 0.44
195 0.5
196 0.51
197 0.58
198 0.64
199 0.7
200 0.68
201 0.64
202 0.59
203 0.55
204 0.54
205 0.5
206 0.43
207 0.36
208 0.36
209 0.32
210 0.26
211 0.23
212 0.17
213 0.13
214 0.13
215 0.11
216 0.08
217 0.07
218 0.07
219 0.06
220 0.07
221 0.09
222 0.12
223 0.16
224 0.2
225 0.23
226 0.28
227 0.38
228 0.46
229 0.53
230 0.59
231 0.66
232 0.72
233 0.8
234 0.84
235 0.85
236 0.87
237 0.84
238 0.8
239 0.78
240 0.79
241 0.78
242 0.79
243 0.71
244 0.67
245 0.66
246 0.63
247 0.53
248 0.43
249 0.37
250 0.26
251 0.24
252 0.17
253 0.12
254 0.1
255 0.1
256 0.09
257 0.06
258 0.09
259 0.08
260 0.1
261 0.1
262 0.1
263 0.1
264 0.1
265 0.11
266 0.09
267 0.1
268 0.09
269 0.09
270 0.09
271 0.09
272 0.09
273 0.08
274 0.07
275 0.07
276 0.1
277 0.11
278 0.12
279 0.17
280 0.19
281 0.2
282 0.23
283 0.26
284 0.25
285 0.25
286 0.25
287 0.2
288 0.18
289 0.18
290 0.15
291 0.11
292 0.09
293 0.09
294 0.08
295 0.08
296 0.08
297 0.08
298 0.09
299 0.09
300 0.13
301 0.14
302 0.16
303 0.22
304 0.28
305 0.31
306 0.37
307 0.46
308 0.47
309 0.56
310 0.64
311 0.68
312 0.68
313 0.66
314 0.61
315 0.58
316 0.57
317 0.49
318 0.43
319 0.35
320 0.3
321 0.34
322 0.38
323 0.39
324 0.4
325 0.39
326 0.39
327 0.44
328 0.48
329 0.46
330 0.46
331 0.47
332 0.5
333 0.55
334 0.56
335 0.53
336 0.49
337 0.48
338 0.45
339 0.42
340 0.44
341 0.41
342 0.41
343 0.42
344 0.42
345 0.41
346 0.46
347 0.48
348 0.48
349 0.55
350 0.56
351 0.57
352 0.61
353 0.65
354 0.66
355 0.68
356 0.64
357 0.61
358 0.63
359 0.66
360 0.64
361 0.6
362 0.53
363 0.49
364 0.46
365 0.39
366 0.31
367 0.23
368 0.21
369 0.19