Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ABP2

Protein Details
Accession A0A166ABP2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
99-120PTDDDLKKKKNKRLSMFSRQASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR039540  UBL3-like_ubiquitin_dom  
Pfam View protein in Pfam  
PF13881  Rad60-SLD_2  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MTFEPETTIGRVKELVWNAWPGEWQDERPPAPSYLRILHLGKILQDEDTLAKLQIASYTPSAAYLPHPQSPASAVSSRMSAQLPPTTIVHLSIRPYSGPTDDDLKKKKNKRLSMFSRQASSVALGAPDENAAVEERGGCCGCTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.23
4 0.25
5 0.24
6 0.24
7 0.24
8 0.19
9 0.22
10 0.21
11 0.21
12 0.24
13 0.29
14 0.3
15 0.31
16 0.32
17 0.29
18 0.3
19 0.3
20 0.28
21 0.26
22 0.28
23 0.29
24 0.28
25 0.28
26 0.28
27 0.25
28 0.22
29 0.21
30 0.19
31 0.14
32 0.13
33 0.12
34 0.1
35 0.11
36 0.11
37 0.08
38 0.08
39 0.07
40 0.07
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.1
49 0.09
50 0.1
51 0.14
52 0.17
53 0.18
54 0.19
55 0.19
56 0.19
57 0.2
58 0.19
59 0.15
60 0.13
61 0.12
62 0.12
63 0.13
64 0.13
65 0.13
66 0.12
67 0.1
68 0.11
69 0.12
70 0.13
71 0.13
72 0.13
73 0.13
74 0.12
75 0.14
76 0.13
77 0.13
78 0.14
79 0.14
80 0.14
81 0.13
82 0.14
83 0.14
84 0.14
85 0.13
86 0.13
87 0.19
88 0.22
89 0.29
90 0.34
91 0.41
92 0.49
93 0.56
94 0.63
95 0.66
96 0.72
97 0.74
98 0.78
99 0.8
100 0.82
101 0.83
102 0.78
103 0.71
104 0.62
105 0.53
106 0.43
107 0.35
108 0.25
109 0.16
110 0.13
111 0.1
112 0.09
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.09
122 0.1
123 0.14
124 0.14