Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166PJC8

Protein Details
Accession A0A166PJC8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-96ADAGWGDWRRRKRYRKWRRPTRRQGSVYBasic
NLS Segment(s)
PositionSequence
77-91RRRKRYRKWRRPTRR
Subcellular Location(s) nucl 9, cyto 7, cysk 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MALQWVEVWENATGGEDADAEIPVIWLCTCIHYDTLPLRQGHSAKEASRDDRGFRRELETQGCDEAVGADAGWGDWRRRKRYRKWRRPTRRQGSVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.06
5 0.07
6 0.07
7 0.06
8 0.05
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.09
18 0.1
19 0.1
20 0.13
21 0.14
22 0.19
23 0.22
24 0.21
25 0.21
26 0.24
27 0.25
28 0.24
29 0.25
30 0.23
31 0.19
32 0.25
33 0.25
34 0.24
35 0.28
36 0.27
37 0.26
38 0.29
39 0.31
40 0.27
41 0.26
42 0.28
43 0.27
44 0.29
45 0.31
46 0.27
47 0.25
48 0.24
49 0.23
50 0.18
51 0.15
52 0.12
53 0.08
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.07
60 0.08
61 0.11
62 0.17
63 0.26
64 0.35
65 0.45
66 0.55
67 0.64
68 0.74
69 0.82
70 0.88
71 0.91
72 0.94
73 0.95
74 0.97
75 0.97
76 0.96