Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AX36

Protein Details
Accession A0A166AX36    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-58ARDGRRRQSVQRARRRGRNGIBasic
NLS Segment(s)
PositionSequence
39-58RDGRRRQSVQRARRRGRNGI
Subcellular Location(s) extr 14, cyto 5.5, mito 5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MNILLVLIAHHYSYGLLTPPSTPYLVHFAWSPSEKQHARDGRRRQSVQRARRRGRNGIWRAVLHVQARLHRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.11
7 0.12
8 0.12
9 0.11
10 0.12
11 0.17
12 0.17
13 0.17
14 0.15
15 0.14
16 0.17
17 0.18
18 0.17
19 0.13
20 0.2
21 0.21
22 0.22
23 0.3
24 0.34
25 0.39
26 0.47
27 0.55
28 0.57
29 0.65
30 0.66
31 0.64
32 0.68
33 0.72
34 0.73
35 0.74
36 0.76
37 0.74
38 0.81
39 0.82
40 0.79
41 0.78
42 0.78
43 0.74
44 0.71
45 0.69
46 0.61
47 0.59
48 0.53
49 0.5
50 0.41
51 0.39
52 0.35