Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166A491

Protein Details
Accession A0A166A491    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
66-93LAPASQVRRHRRARPSRRSRTSLCRRTEHydrophilic
NLS Segment(s)
PositionSequence
73-84RRHRRARPSRRS
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVGSNAPELDFARPNVCALGECEEKEEREGQGGRGGGAGAGAGTEEGAQAEGTDEEAQGGRGGAGLAPASQVRRHRRARPSRRSRTSLCRRTEYIYVPYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.13
5 0.12
6 0.17
7 0.18
8 0.17
9 0.2
10 0.21
11 0.21
12 0.22
13 0.22
14 0.16
15 0.19
16 0.2
17 0.17
18 0.2
19 0.19
20 0.17
21 0.15
22 0.15
23 0.09
24 0.08
25 0.07
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.07
57 0.11
58 0.19
59 0.27
60 0.36
61 0.44
62 0.52
63 0.62
64 0.72
65 0.8
66 0.83
67 0.87
68 0.89
69 0.9
70 0.88
71 0.85
72 0.85
73 0.85
74 0.83
75 0.79
76 0.74
77 0.68
78 0.66
79 0.65
80 0.59