Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WB94

Protein Details
Accession G0WB94   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKIPWRLSSHQKYRQRNRLKHVDEHydrophilic
106-125KKVKGYRKGIHKVPKWTKISBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG ndi:NDAI_0E01980  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKSTSPSLGGLLWKIPWRLSSHQKYRQRNRLKHVDEVIKQITTGLHVMRCEDKGIEYKKAISMPKKQMFKPRMASLRLLNKSSFFPKEFQMSSKDKYTVFDKKVKGYRKGIHKVPKWTKISMRQNPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.19
5 0.19
6 0.19
7 0.2
8 0.24
9 0.3
10 0.39
11 0.47
12 0.53
13 0.62
14 0.71
15 0.79
16 0.84
17 0.87
18 0.88
19 0.86
20 0.84
21 0.85
22 0.79
23 0.76
24 0.72
25 0.7
26 0.61
27 0.59
28 0.52
29 0.41
30 0.37
31 0.3
32 0.23
33 0.16
34 0.15
35 0.11
36 0.1
37 0.1
38 0.12
39 0.13
40 0.14
41 0.13
42 0.12
43 0.12
44 0.17
45 0.2
46 0.21
47 0.2
48 0.2
49 0.21
50 0.25
51 0.27
52 0.25
53 0.31
54 0.38
55 0.44
56 0.47
57 0.48
58 0.54
59 0.53
60 0.55
61 0.52
62 0.49
63 0.48
64 0.46
65 0.46
66 0.42
67 0.49
68 0.45
69 0.41
70 0.35
71 0.31
72 0.32
73 0.33
74 0.31
75 0.23
76 0.22
77 0.23
78 0.28
79 0.27
80 0.26
81 0.29
82 0.3
83 0.32
84 0.34
85 0.34
86 0.29
87 0.31
88 0.36
89 0.38
90 0.39
91 0.43
92 0.42
93 0.48
94 0.56
95 0.61
96 0.63
97 0.63
98 0.65
99 0.68
100 0.73
101 0.74
102 0.76
103 0.75
104 0.78
105 0.79
106 0.81
107 0.75
108 0.73
109 0.73
110 0.73
111 0.77
112 0.76
113 0.78