Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XT52

Protein Details
Accession A0A165XT52    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-26RASLNRRKPSGEKKKPPTLEEBasic
NLS Segment(s)
PositionSequence
2-21KRRARASLNRRKPSGEKKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKRRARASLNRRKPSGEKKKPPTLEEEPPIQPSSPADNYSSPSSIAPTLKTVTILCDRYAIDYVFPSYQNCAWWDQLRDAGVNLQADDAEAYEEWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.76
4 0.76
5 0.76
6 0.84
7 0.84
8 0.77
9 0.74
10 0.69
11 0.66
12 0.59
13 0.55
14 0.46
15 0.44
16 0.43
17 0.34
18 0.28
19 0.21
20 0.24
21 0.2
22 0.2
23 0.19
24 0.19
25 0.22
26 0.24
27 0.22
28 0.17
29 0.15
30 0.15
31 0.14
32 0.14
33 0.12
34 0.11
35 0.12
36 0.11
37 0.12
38 0.1
39 0.12
40 0.15
41 0.16
42 0.15
43 0.16
44 0.16
45 0.17
46 0.18
47 0.15
48 0.11
49 0.11
50 0.13
51 0.12
52 0.12
53 0.11
54 0.12
55 0.13
56 0.15
57 0.16
58 0.16
59 0.19
60 0.22
61 0.24
62 0.24
63 0.26
64 0.25
65 0.24
66 0.22
67 0.21
68 0.2
69 0.18
70 0.16
71 0.13
72 0.12
73 0.12
74 0.11
75 0.09
76 0.08