Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UU58

Protein Details
Accession E4UU58    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-86KTPKSKSSCKNGKVNKKRAAEHydrophilic
NLS Segment(s)
PositionSequence
81-81K
Subcellular Location(s) cyto 16, cyto_nucl 12, mito 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MAITWDDRVDAKLLFAIITTSATKIDYKAVAEIIGEGCTPKAIQHRLARIKLKANEGNRESSSPAKTPKSKSSCKNGKVNKKRAAEILEEEAGDSKKIKQGEMKEADSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.07
5 0.09
6 0.09
7 0.09
8 0.09
9 0.1
10 0.11
11 0.11
12 0.13
13 0.13
14 0.13
15 0.13
16 0.13
17 0.12
18 0.11
19 0.12
20 0.09
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.13
29 0.15
30 0.22
31 0.26
32 0.35
33 0.41
34 0.47
35 0.49
36 0.46
37 0.51
38 0.47
39 0.49
40 0.46
41 0.42
42 0.44
43 0.41
44 0.42
45 0.36
46 0.34
47 0.29
48 0.27
49 0.26
50 0.22
51 0.25
52 0.27
53 0.32
54 0.36
55 0.44
56 0.48
57 0.53
58 0.57
59 0.63
60 0.67
61 0.68
62 0.73
63 0.73
64 0.77
65 0.8
66 0.83
67 0.82
68 0.76
69 0.72
70 0.68
71 0.62
72 0.54
73 0.48
74 0.42
75 0.34
76 0.3
77 0.27
78 0.25
79 0.21
80 0.18
81 0.15
82 0.13
83 0.16
84 0.17
85 0.19
86 0.24
87 0.3
88 0.4
89 0.46
90 0.47