Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167U9I8

Protein Details
Accession A0A167U9I8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-130GYDRCTGRRGKARNASRQRRRRRRGGVKTVRBasic
NLS Segment(s)
PositionSequence
107-130RRGKARNASRQRRRRRRGGVKTVR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPPQQQQQPFLGHYRASLPSQREHKAPTSTQVTLVLRLLQLELRPRLPSLPPRRPDGPDPETLRIAADTISRDLSVAQVAQGTHVKSGADVCQGRYQISGYDRCTGRRGKARNASRQRRRRRRGGVKTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.3
5 0.29
6 0.34
7 0.4
8 0.42
9 0.41
10 0.42
11 0.44
12 0.45
13 0.43
14 0.42
15 0.41
16 0.39
17 0.37
18 0.39
19 0.34
20 0.29
21 0.28
22 0.22
23 0.16
24 0.16
25 0.15
26 0.1
27 0.11
28 0.15
29 0.17
30 0.17
31 0.18
32 0.18
33 0.2
34 0.22
35 0.3
36 0.35
37 0.42
38 0.43
39 0.47
40 0.5
41 0.52
42 0.52
43 0.51
44 0.45
45 0.43
46 0.44
47 0.41
48 0.38
49 0.35
50 0.31
51 0.22
52 0.18
53 0.12
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.06
66 0.06
67 0.08
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.11
75 0.1
76 0.14
77 0.15
78 0.17
79 0.21
80 0.21
81 0.21
82 0.21
83 0.2
84 0.18
85 0.21
86 0.24
87 0.22
88 0.29
89 0.3
90 0.31
91 0.36
92 0.36
93 0.4
94 0.44
95 0.48
96 0.51
97 0.6
98 0.67
99 0.73
100 0.8
101 0.83
102 0.85
103 0.9
104 0.91
105 0.92
106 0.92
107 0.92
108 0.92
109 0.93
110 0.93