Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166SWY1

Protein Details
Accession A0A166SWY1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
41-68QSKRRTGDTIRGRRWRRRSRRVVLVLGVHydrophilic
NLS Segment(s)
PositionSequence
49-61TIRGRRWRRRSRR
Subcellular Location(s) extr 12, cyto 6, mito 5, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MHVVPKVSGSLDVQAVALSFGAGVFLSSSSDLGPVNRLGDQSKRRTGDTIRGRRWRRRSRRVVLVLGVFVLYSRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.07
5 0.05
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.04
14 0.04
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.08
24 0.09
25 0.1
26 0.16
27 0.22
28 0.26
29 0.32
30 0.33
31 0.33
32 0.36
33 0.37
34 0.4
35 0.45
36 0.5
37 0.52
38 0.6
39 0.66
40 0.73
41 0.82
42 0.83
43 0.83
44 0.84
45 0.86
46 0.85
47 0.89
48 0.87
49 0.81
50 0.75
51 0.66
52 0.55
53 0.44
54 0.35
55 0.24
56 0.17