Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166TCZ5

Protein Details
Accession A0A166TCZ5   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-127LYKNGAIHYKHNRNRRHSRRISALLKRSTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_mito 10.832, cyto_nucl 9.333, mito 8.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MSLPMLTILITGFNKGIGFEIALHLSKLEHIHLFVSGRNPALVQQSASSLKAEEGCQAIIDNVVLDISDDLSIQAAVREVEAKLGGAALDVLVNNAGILYKNGAIHYKHNRNRRHSRRISALLKRSTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.08
5 0.09
6 0.08
7 0.1
8 0.12
9 0.12
10 0.12
11 0.11
12 0.1
13 0.11
14 0.12
15 0.12
16 0.1
17 0.11
18 0.11
19 0.13
20 0.13
21 0.13
22 0.15
23 0.14
24 0.14
25 0.13
26 0.13
27 0.13
28 0.16
29 0.15
30 0.13
31 0.12
32 0.14
33 0.16
34 0.16
35 0.15
36 0.11
37 0.11
38 0.12
39 0.12
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.07
47 0.06
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.06
87 0.08
88 0.09
89 0.1
90 0.14
91 0.16
92 0.24
93 0.34
94 0.43
95 0.49
96 0.57
97 0.65
98 0.71
99 0.81
100 0.83
101 0.84
102 0.83
103 0.84
104 0.85
105 0.86
106 0.86
107 0.85
108 0.84
109 0.8