Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166TRY5

Protein Details
Accession A0A166TRY5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
101-127RVTTPDRQPKRTARRSGKPYARPTPAAHydrophilic
NLS Segment(s)
PositionSequence
111-117RTARRSG
Subcellular Location(s) nucl 7, mito 6, cyto 6, pero 6, cyto_mito 6, cyto_pero 6
Family & Domain DBs
Amino Acid Sequences MPTDIVLAAMSAARDACFARGEPEQERYQENGLGPEALWEFDEDVNIVLNRPHTRGDVQRAMKYSKNDWIRMTFYPICPWCECSDDYCWFNNGVCDLQAPRVTTPDRQPKRTARRSGKPYARPTPAAHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.1
6 0.13
7 0.16
8 0.2
9 0.22
10 0.26
11 0.28
12 0.28
13 0.31
14 0.3
15 0.28
16 0.27
17 0.25
18 0.22
19 0.19
20 0.18
21 0.15
22 0.14
23 0.13
24 0.1
25 0.1
26 0.08
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.06
36 0.1
37 0.11
38 0.12
39 0.13
40 0.13
41 0.17
42 0.21
43 0.27
44 0.32
45 0.33
46 0.35
47 0.36
48 0.37
49 0.38
50 0.36
51 0.31
52 0.3
53 0.32
54 0.31
55 0.3
56 0.31
57 0.31
58 0.29
59 0.34
60 0.28
61 0.25
62 0.29
63 0.28
64 0.29
65 0.26
66 0.28
67 0.22
68 0.23
69 0.23
70 0.2
71 0.24
72 0.24
73 0.25
74 0.24
75 0.24
76 0.21
77 0.21
78 0.19
79 0.16
80 0.12
81 0.11
82 0.11
83 0.11
84 0.14
85 0.17
86 0.18
87 0.17
88 0.21
89 0.23
90 0.26
91 0.34
92 0.42
93 0.46
94 0.5
95 0.57
96 0.63
97 0.72
98 0.77
99 0.79
100 0.78
101 0.81
102 0.85
103 0.87
104 0.87
105 0.85
106 0.85
107 0.84
108 0.8
109 0.74