Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V4I2

Protein Details
Accession E4V4I2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35MLQFRPKVLRTPRKRVYQQKLCQSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MAHLDINPVMLQFRPKVLRTPRKRVYQQKLCQSLVMRAVLYCGCDATSTVRNQGNDRLVHLHVDDDDLAAMSGKAGILSSPRANPASHLAFLGYQKACEGLLYTLIKVTVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.33
4 0.43
5 0.53
6 0.59
7 0.68
8 0.7
9 0.76
10 0.84
11 0.86
12 0.86
13 0.86
14 0.85
15 0.84
16 0.83
17 0.74
18 0.67
19 0.58
20 0.5
21 0.43
22 0.36
23 0.25
24 0.18
25 0.19
26 0.16
27 0.15
28 0.11
29 0.08
30 0.06
31 0.06
32 0.07
33 0.09
34 0.13
35 0.13
36 0.18
37 0.2
38 0.21
39 0.22
40 0.26
41 0.27
42 0.22
43 0.23
44 0.22
45 0.2
46 0.19
47 0.18
48 0.14
49 0.1
50 0.11
51 0.09
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.05
65 0.08
66 0.1
67 0.11
68 0.15
69 0.16
70 0.16
71 0.18
72 0.23
73 0.24
74 0.22
75 0.21
76 0.19
77 0.2
78 0.21
79 0.26
80 0.19
81 0.16
82 0.16
83 0.16
84 0.15
85 0.13
86 0.14
87 0.09
88 0.15
89 0.16
90 0.16
91 0.16