Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167UBL9

Protein Details
Accession A0A167UBL9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-40YRGVRRVWRGADRRRGRRRGHDRFRGRGSABasic
NLS Segment(s)
PositionSequence
5-43RRGRRGYRGVRRVWRGADRRRGRRRGHDRFRGRGSARAE
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAGFRRGRRGYRGVRRVWRGADRRRGRRRGHDRFRGRGSARAEARYGRCAVVDSGRRRRGGRLGDVLQNVDRIGPWASKILPDHLLEGRESLGLDVELPVQVLAHLPLHLVHLPQLEHSLPDNPQDLFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.77
4 0.74
5 0.73
6 0.71
7 0.72
8 0.74
9 0.75
10 0.79
11 0.83
12 0.86
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.87
19 0.85
20 0.84
21 0.82
22 0.8
23 0.7
24 0.66
25 0.59
26 0.57
27 0.51
28 0.45
29 0.41
30 0.37
31 0.37
32 0.34
33 0.3
34 0.22
35 0.2
36 0.18
37 0.18
38 0.19
39 0.25
40 0.29
41 0.37
42 0.41
43 0.43
44 0.43
45 0.45
46 0.45
47 0.42
48 0.39
49 0.36
50 0.34
51 0.35
52 0.35
53 0.33
54 0.27
55 0.23
56 0.18
57 0.12
58 0.09
59 0.07
60 0.08
61 0.07
62 0.07
63 0.09
64 0.09
65 0.11
66 0.12
67 0.14
68 0.16
69 0.16
70 0.18
71 0.18
72 0.19
73 0.16
74 0.16
75 0.14
76 0.11
77 0.11
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.1
96 0.11
97 0.11
98 0.12
99 0.14
100 0.15
101 0.15
102 0.19
103 0.16
104 0.17
105 0.18
106 0.2
107 0.19
108 0.22
109 0.24