Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166SB95

Protein Details
Accession A0A166SB95    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-83DTLVTPRKTWRHRVRGNHYHYQWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 3, extr 3, pero 2
Family & Domain DBs
Amino Acid Sequences MPLVEPVPHVKAFPALTFPAGAAPGSKVTLTFNKATPPTLFTPRSTPARVQSKYAKIDPSDTLVTPRKTWRHRVRGNHYHYQWHDERGYQPCCRSGLFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.18
4 0.18
5 0.17
6 0.14
7 0.13
8 0.12
9 0.08
10 0.09
11 0.09
12 0.09
13 0.09
14 0.08
15 0.11
16 0.15
17 0.18
18 0.18
19 0.18
20 0.22
21 0.23
22 0.25
23 0.23
24 0.23
25 0.23
26 0.28
27 0.28
28 0.25
29 0.28
30 0.3
31 0.34
32 0.32
33 0.3
34 0.31
35 0.38
36 0.38
37 0.38
38 0.4
39 0.42
40 0.44
41 0.45
42 0.4
43 0.31
44 0.33
45 0.3
46 0.28
47 0.23
48 0.19
49 0.23
50 0.26
51 0.27
52 0.26
53 0.32
54 0.37
55 0.4
56 0.51
57 0.56
58 0.61
59 0.68
60 0.76
61 0.8
62 0.82
63 0.85
64 0.84
65 0.75
66 0.74
67 0.67
68 0.65
69 0.57
70 0.52
71 0.46
72 0.39
73 0.43
74 0.42
75 0.46
76 0.43
77 0.43
78 0.41
79 0.42