Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166PTU9

Protein Details
Accession A0A166PTU9    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-51PATSKLTTASKKPKKTPPAKASGANTRSRSKSKTQAQKIKSKKFVEDHydrophilic
66-89GKEEPKVIPERPKPRPKIRFADTTBasic
NLS Segment(s)
PositionSequence
14-46SKKPKKTPPAKASGANTRSRSKSKTQAQKIKSK
71-82KVIPERPKPRPK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MKPPPATSKLTTASKKPKKTPPAKASGANTRSRSKSKTQAQKIKSKKFVEDSDVDMDGTVEDDKPGKEEPKVIPERPKPRPKIRFADTTQEGVAKSSMQQPPPSSSQPPRPTAVPSMNIMSPEISDAKLSKLPGWHPDVKAALKHAFPQPALMSKSILAVESRHTAPAPSPSPSPPPSSRVPSRSIHSYDRGRDRNSTYRQSVARSRESARDNFSNERPIVPSAAPSAAPSPHTEYRRSGTPLARLHPERRGSAPQAAPSPLPDYHGGYGAYGGYGSQDTRGGYDAQGAHGGYSSQGAQGGYPGYTRVEERHNGHYVSEHEWYGYAPGSSGYLSGPGSRGYDDPFNHRFQPAHYTPSMHGTSYPVHDPCHYDSESHRSRYLQAPLPSQHHVPYAPPLSAHPRRHPDDLTVISLSRTATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.76
4 0.79
5 0.81
6 0.87
7 0.89
8 0.87
9 0.87
10 0.84
11 0.82
12 0.78
13 0.78
14 0.74
15 0.71
16 0.65
17 0.63
18 0.64
19 0.63
20 0.62
21 0.59
22 0.63
23 0.65
24 0.71
25 0.75
26 0.79
27 0.8
28 0.85
29 0.87
30 0.87
31 0.86
32 0.8
33 0.77
34 0.74
35 0.71
36 0.68
37 0.6
38 0.55
39 0.49
40 0.45
41 0.37
42 0.3
43 0.24
44 0.17
45 0.15
46 0.11
47 0.07
48 0.07
49 0.1
50 0.1
51 0.12
52 0.16
53 0.18
54 0.19
55 0.25
56 0.28
57 0.37
58 0.44
59 0.46
60 0.53
61 0.59
62 0.67
63 0.71
64 0.78
65 0.77
66 0.8
67 0.85
68 0.84
69 0.84
70 0.8
71 0.8
72 0.73
73 0.74
74 0.66
75 0.59
76 0.5
77 0.43
78 0.37
79 0.28
80 0.25
81 0.15
82 0.14
83 0.2
84 0.24
85 0.24
86 0.28
87 0.29
88 0.34
89 0.39
90 0.42
91 0.4
92 0.41
93 0.49
94 0.52
95 0.53
96 0.51
97 0.47
98 0.47
99 0.46
100 0.45
101 0.37
102 0.31
103 0.3
104 0.29
105 0.28
106 0.24
107 0.18
108 0.13
109 0.13
110 0.12
111 0.09
112 0.1
113 0.1
114 0.12
115 0.14
116 0.15
117 0.15
118 0.18
119 0.2
120 0.24
121 0.31
122 0.34
123 0.32
124 0.35
125 0.36
126 0.34
127 0.33
128 0.31
129 0.27
130 0.22
131 0.25
132 0.26
133 0.25
134 0.24
135 0.25
136 0.22
137 0.25
138 0.26
139 0.23
140 0.19
141 0.17
142 0.18
143 0.16
144 0.15
145 0.1
146 0.09
147 0.11
148 0.13
149 0.14
150 0.13
151 0.13
152 0.12
153 0.13
154 0.19
155 0.19
156 0.17
157 0.19
158 0.2
159 0.26
160 0.27
161 0.32
162 0.28
163 0.3
164 0.32
165 0.37
166 0.4
167 0.38
168 0.41
169 0.38
170 0.39
171 0.41
172 0.41
173 0.38
174 0.39
175 0.4
176 0.41
177 0.47
178 0.49
179 0.45
180 0.45
181 0.46
182 0.49
183 0.5
184 0.5
185 0.43
186 0.43
187 0.43
188 0.42
189 0.43
190 0.4
191 0.38
192 0.35
193 0.35
194 0.37
195 0.39
196 0.38
197 0.36
198 0.33
199 0.33
200 0.33
201 0.32
202 0.31
203 0.28
204 0.26
205 0.23
206 0.21
207 0.2
208 0.16
209 0.15
210 0.11
211 0.12
212 0.11
213 0.1
214 0.11
215 0.09
216 0.1
217 0.11
218 0.16
219 0.21
220 0.23
221 0.25
222 0.26
223 0.28
224 0.32
225 0.34
226 0.32
227 0.29
228 0.34
229 0.36
230 0.36
231 0.39
232 0.38
233 0.38
234 0.4
235 0.4
236 0.35
237 0.35
238 0.37
239 0.34
240 0.38
241 0.36
242 0.32
243 0.32
244 0.31
245 0.27
246 0.23
247 0.24
248 0.17
249 0.18
250 0.16
251 0.16
252 0.16
253 0.18
254 0.16
255 0.13
256 0.13
257 0.1
258 0.09
259 0.06
260 0.06
261 0.04
262 0.05
263 0.05
264 0.05
265 0.07
266 0.07
267 0.08
268 0.09
269 0.1
270 0.09
271 0.14
272 0.13
273 0.13
274 0.14
275 0.13
276 0.12
277 0.11
278 0.11
279 0.07
280 0.08
281 0.07
282 0.06
283 0.07
284 0.07
285 0.07
286 0.08
287 0.09
288 0.08
289 0.08
290 0.08
291 0.08
292 0.09
293 0.1
294 0.12
295 0.17
296 0.22
297 0.26
298 0.32
299 0.34
300 0.34
301 0.33
302 0.34
303 0.31
304 0.29
305 0.28
306 0.21
307 0.18
308 0.17
309 0.17
310 0.15
311 0.14
312 0.09
313 0.07
314 0.07
315 0.08
316 0.08
317 0.08
318 0.07
319 0.08
320 0.08
321 0.09
322 0.1
323 0.1
324 0.12
325 0.13
326 0.13
327 0.15
328 0.21
329 0.22
330 0.29
331 0.32
332 0.34
333 0.35
334 0.37
335 0.34
336 0.3
337 0.38
338 0.33
339 0.35
340 0.33
341 0.34
342 0.33
343 0.39
344 0.38
345 0.29
346 0.27
347 0.23
348 0.25
349 0.26
350 0.3
351 0.24
352 0.25
353 0.26
354 0.3
355 0.31
356 0.35
357 0.31
358 0.28
359 0.3
360 0.39
361 0.44
362 0.44
363 0.42
364 0.38
365 0.41
366 0.46
367 0.5
368 0.48
369 0.46
370 0.5
371 0.53
372 0.56
373 0.55
374 0.5
375 0.45
376 0.4
377 0.36
378 0.31
379 0.33
380 0.32
381 0.29
382 0.27
383 0.29
384 0.36
385 0.45
386 0.5
387 0.51
388 0.57
389 0.62
390 0.67
391 0.66
392 0.61
393 0.6
394 0.56
395 0.51
396 0.44
397 0.39
398 0.33
399 0.33