Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166P1H3

Protein Details
Accession A0A166P1H3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-129APPTAKQKAPSPAKRRPRKSTTVVPQPSTHydrophilic
NLS Segment(s)
PositionSequence
105-119AKQKAPSPAKRRPRK
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTPKANSMDVEPTMTASGTDVPRAAIVNDSPSLASPASSPLSDALNPPYKLVEFRRSTRSTAPLVVLSAVPLNQGIVQSAPLLSAGSTEPDISEPAKSSAPPTAKQKAPSPAKRRPRKSTTVVPQPSTRVSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.15
4 0.1
5 0.14
6 0.13
7 0.14
8 0.13
9 0.12
10 0.13
11 0.14
12 0.13
13 0.1
14 0.1
15 0.12
16 0.12
17 0.13
18 0.12
19 0.12
20 0.13
21 0.11
22 0.11
23 0.08
24 0.1
25 0.11
26 0.11
27 0.11
28 0.1
29 0.12
30 0.12
31 0.13
32 0.15
33 0.21
34 0.22
35 0.21
36 0.21
37 0.2
38 0.23
39 0.26
40 0.29
41 0.26
42 0.29
43 0.37
44 0.38
45 0.4
46 0.41
47 0.4
48 0.33
49 0.31
50 0.28
51 0.2
52 0.18
53 0.16
54 0.13
55 0.09
56 0.07
57 0.06
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.09
82 0.09
83 0.11
84 0.12
85 0.12
86 0.13
87 0.19
88 0.22
89 0.25
90 0.31
91 0.37
92 0.4
93 0.44
94 0.49
95 0.52
96 0.59
97 0.65
98 0.66
99 0.69
100 0.76
101 0.83
102 0.86
103 0.86
104 0.84
105 0.83
106 0.83
107 0.83
108 0.83
109 0.83
110 0.8
111 0.75
112 0.7
113 0.66