Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UVJ7

Protein Details
Accession E4UVJ7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-36ATKQPRAPGRRRHKEPIARAPLBasic
NLS Segment(s)
PositionSequence
17-30KQPRAPGRRRHKEP
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MQTGYSQGSLRVRLATKQPRAPGRRRHKEPIARAPLHLLNLSLTSTRQLNWLYYYYRRSSGQAPALYPTWNPFNQDIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.45
4 0.49
5 0.55
6 0.6
7 0.66
8 0.71
9 0.72
10 0.73
11 0.77
12 0.78
13 0.8
14 0.8
15 0.81
16 0.81
17 0.81
18 0.79
19 0.69
20 0.62
21 0.57
22 0.49
23 0.41
24 0.32
25 0.21
26 0.12
27 0.12
28 0.12
29 0.08
30 0.07
31 0.07
32 0.08
33 0.08
34 0.1
35 0.11
36 0.11
37 0.13
38 0.16
39 0.18
40 0.22
41 0.26
42 0.26
43 0.28
44 0.29
45 0.29
46 0.3
47 0.34
48 0.38
49 0.36
50 0.34
51 0.34
52 0.34
53 0.32
54 0.29
55 0.26
56 0.24
57 0.23
58 0.26