Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166MXV5

Protein Details
Accession A0A166MXV5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-70MGRPGSRVARKRKKARIGFGHRVTKGBasic
NLS Segment(s)
PositionSequence
48-62PGSRVARKRKKARIG
Subcellular Location(s) cyto 13.5, cyto_pero 8, nucl 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR031309  Ribosomal_L5_C  
IPR022803  Ribosomal_L5_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00673  Ribosomal_L5_C  
Amino Acid Sequences VKEYRLGRNFSETGNFGFGVQEHIDLGVQYDPGVDIFGMEFHAVMGRPGSRVARKRKKARIGFGHRVTKGDTQAWLRQRFDGIIQYHPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.18
4 0.17
5 0.16
6 0.15
7 0.14
8 0.12
9 0.09
10 0.1
11 0.09
12 0.09
13 0.1
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.07
36 0.1
37 0.15
38 0.23
39 0.34
40 0.44
41 0.54
42 0.63
43 0.72
44 0.79
45 0.81
46 0.83
47 0.83
48 0.83
49 0.83
50 0.82
51 0.8
52 0.71
53 0.64
54 0.58
55 0.51
56 0.45
57 0.37
58 0.32
59 0.29
60 0.35
61 0.42
62 0.44
63 0.42
64 0.4
65 0.4
66 0.37
67 0.35
68 0.35
69 0.3
70 0.28