Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UVD3

Protein Details
Accession E4UVD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24DGWAREQREEKQRSRRRAGRVFMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 6, cyto 3, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDGWAREQREEKQRSRRRAGRVFMIMIFIPIVRPVRRFWAVRLGAPSSLSQSHQVPSAHLQPSEGYGYTYGPTAGRSAGFVINIVTAGAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.81
4 0.8
5 0.81
6 0.78
7 0.75
8 0.7
9 0.63
10 0.52
11 0.47
12 0.37
13 0.28
14 0.22
15 0.14
16 0.09
17 0.09
18 0.12
19 0.11
20 0.13
21 0.13
22 0.19
23 0.24
24 0.25
25 0.24
26 0.31
27 0.31
28 0.31
29 0.33
30 0.28
31 0.24
32 0.24
33 0.22
34 0.14
35 0.14
36 0.13
37 0.12
38 0.12
39 0.12
40 0.16
41 0.16
42 0.15
43 0.17
44 0.23
45 0.23
46 0.22
47 0.22
48 0.18
49 0.2
50 0.2
51 0.17
52 0.12
53 0.1
54 0.11
55 0.11
56 0.11
57 0.09
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.11
65 0.12
66 0.12
67 0.11
68 0.11
69 0.1
70 0.1
71 0.09