Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UZG4

Protein Details
Accession E4UZG4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AAPFRPGRDRWRRRAGPLPGBasic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, extr 4
Family & Domain DBs
Amino Acid Sequences MAAPFRPGRDRWRRRAGPLPGHAGLAGLAGEPAIVVARGGDPDIAHDDIRRETVQTECLNIGRVIRISQETACGLGKPFTIYGERDKFRFLIPCKQSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.79
4 0.78
5 0.74
6 0.71
7 0.6
8 0.55
9 0.48
10 0.38
11 0.28
12 0.18
13 0.12
14 0.05
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.04
29 0.05
30 0.08
31 0.09
32 0.09
33 0.09
34 0.11
35 0.11
36 0.13
37 0.12
38 0.09
39 0.09
40 0.1
41 0.15
42 0.14
43 0.15
44 0.14
45 0.14
46 0.15
47 0.14
48 0.14
49 0.1
50 0.11
51 0.1
52 0.11
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.14
59 0.14
60 0.13
61 0.12
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.14
68 0.16
69 0.24
70 0.32
71 0.33
72 0.32
73 0.35
74 0.34
75 0.35
76 0.41
77 0.37
78 0.39
79 0.44