Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4V0M1

Protein Details
Accession E4V0M1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-71TRMIRNCKEGGKKQPKNSGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MGREKSKQSEEVEEAEGSPTGQHKEQEQEQSKQASSKPSSRQTDTDKKMKSTRMIRNCKEGGKKQPKNSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.22
4 0.15
5 0.13
6 0.11
7 0.11
8 0.13
9 0.13
10 0.14
11 0.19
12 0.24
13 0.33
14 0.36
15 0.36
16 0.38
17 0.4
18 0.38
19 0.35
20 0.32
21 0.29
22 0.27
23 0.31
24 0.34
25 0.4
26 0.44
27 0.45
28 0.48
29 0.5
30 0.57
31 0.57
32 0.58
33 0.53
34 0.53
35 0.55
36 0.55
37 0.55
38 0.55
39 0.59
40 0.62
41 0.69
42 0.68
43 0.72
44 0.71
45 0.7
46 0.7
47 0.68
48 0.69
49 0.7
50 0.75
51 0.75