Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TNT7

Protein Details
Accession A7TNT7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27TEQISHKKSLRIKNSNKDKRLQLKEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, cyto 4
Family & Domain DBs
KEGG vpo:Kpol_1016p22  -  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MTEQISHKKSLRIKNSNKDKRLQLKEFYKLNEEVQQDKVKSDSNSSASSPPPIPLPEGIDRVSDTDTQEVSIKENKEVKPVTDFDDTDSIDSRSLENMEDKSVKELYFKDLLHMHNKLLSKETETNNSIKNTIYENYYDLIKVNDLLKGMVDEKSQPLNELKETIEFIIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.85
3 0.88
4 0.85
5 0.82
6 0.81
7 0.81
8 0.81
9 0.76
10 0.74
11 0.71
12 0.74
13 0.72
14 0.65
15 0.59
16 0.51
17 0.48
18 0.45
19 0.4
20 0.35
21 0.35
22 0.38
23 0.34
24 0.32
25 0.31
26 0.29
27 0.27
28 0.29
29 0.28
30 0.26
31 0.27
32 0.29
33 0.3
34 0.26
35 0.28
36 0.25
37 0.2
38 0.19
39 0.17
40 0.17
41 0.15
42 0.19
43 0.19
44 0.21
45 0.21
46 0.19
47 0.19
48 0.19
49 0.19
50 0.16
51 0.13
52 0.12
53 0.12
54 0.12
55 0.13
56 0.12
57 0.13
58 0.16
59 0.16
60 0.18
61 0.25
62 0.24
63 0.28
64 0.28
65 0.27
66 0.26
67 0.27
68 0.27
69 0.24
70 0.23
71 0.19
72 0.21
73 0.21
74 0.17
75 0.17
76 0.13
77 0.11
78 0.11
79 0.1
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.11
86 0.12
87 0.12
88 0.14
89 0.15
90 0.14
91 0.15
92 0.15
93 0.17
94 0.2
95 0.2
96 0.2
97 0.23
98 0.25
99 0.28
100 0.29
101 0.25
102 0.24
103 0.26
104 0.25
105 0.24
106 0.22
107 0.22
108 0.27
109 0.3
110 0.31
111 0.32
112 0.34
113 0.35
114 0.36
115 0.31
116 0.25
117 0.24
118 0.21
119 0.2
120 0.2
121 0.17
122 0.17
123 0.17
124 0.17
125 0.16
126 0.13
127 0.13
128 0.11
129 0.12
130 0.12
131 0.12
132 0.12
133 0.12
134 0.12
135 0.13
136 0.14
137 0.14
138 0.14
139 0.15
140 0.17
141 0.23
142 0.23
143 0.23
144 0.26
145 0.28
146 0.28
147 0.28
148 0.26
149 0.24
150 0.25