Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UNZ6

Protein Details
Accession E4UNZ6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-69EGKMNIKMRKRKKADNENKNLNGHydrophilic
NLS Segment(s)
PositionSequence
53-59KMRKRKK
Subcellular Location(s) mito 17.5, mito_nucl 14, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MALIKISSTHLSSQRFTLVQIPFCYSRNDFMHVSREDIHPTCKERNEGKMNIKMRKRKKADNENKNLNGIMMWARKWNQTEEVELEKGEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.3
5 0.28
6 0.28
7 0.28
8 0.31
9 0.29
10 0.29
11 0.32
12 0.26
13 0.29
14 0.27
15 0.3
16 0.27
17 0.27
18 0.33
19 0.29
20 0.3
21 0.26
22 0.25
23 0.25
24 0.24
25 0.25
26 0.21
27 0.24
28 0.26
29 0.26
30 0.3
31 0.29
32 0.35
33 0.38
34 0.41
35 0.42
36 0.46
37 0.5
38 0.53
39 0.57
40 0.59
41 0.61
42 0.66
43 0.67
44 0.68
45 0.73
46 0.77
47 0.81
48 0.83
49 0.84
50 0.83
51 0.79
52 0.72
53 0.61
54 0.49
55 0.38
56 0.29
57 0.25
58 0.17
59 0.16
60 0.19
61 0.21
62 0.26
63 0.28
64 0.31
65 0.32
66 0.32
67 0.35
68 0.35
69 0.38
70 0.35
71 0.32