Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W6V0

Protein Details
Accession G0W6V0   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-113SLLARKRQLRVETRKKIKQNNFLSQIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ndi:NDAI_0B04770  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRLFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.3
5 0.28
6 0.25
7 0.22
8 0.16
9 0.14
10 0.13
11 0.12
12 0.07
13 0.08
14 0.08
15 0.09
16 0.09
17 0.08
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.11
27 0.14
28 0.2
29 0.21
30 0.2
31 0.24
32 0.26
33 0.25
34 0.25
35 0.27
36 0.21
37 0.23
38 0.23
39 0.23
40 0.28
41 0.27
42 0.27
43 0.24
44 0.24
45 0.22
46 0.22
47 0.17
48 0.11
49 0.11
50 0.1
51 0.07
52 0.06
53 0.08
54 0.07
55 0.1
56 0.1
57 0.1
58 0.14
59 0.19
60 0.23
61 0.22
62 0.25
63 0.26
64 0.28
65 0.31
66 0.29
67 0.27
68 0.26
69 0.29
70 0.28
71 0.27
72 0.24
73 0.21
74 0.21
75 0.22
76 0.25
77 0.23
78 0.24
79 0.27
80 0.32
81 0.38
82 0.45
83 0.5
84 0.56
85 0.67
86 0.74
87 0.79
88 0.84
89 0.85
90 0.88
91 0.88
92 0.87
93 0.85