Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UNE4

Protein Details
Accession E4UNE4    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-76VESAPVRKKRKIEPKPRITRHLDLTHydrophilic
458-488QNGARTKMVKKPSQPRKPRAKKTKAADASAKHydrophilic
NLS Segment(s)
PositionSequence
58-68RKKRKIEPKPR
455-489PPKQNGARTKMVKKPSQPRKPRAKKTKAADASAKT
499-500RK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR003000  Sirtuin  
IPR026591  Sirtuin_cat_small_dom_sf  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0070403  F:NAD+ binding  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF02146  SIR2  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
Amino Acid Sequences MDFELSDTSSELSSLPSTPPSEDSLYPSPPASQLFQVQSAAASSTAAEEVVVESAPVRKKRKIEPKPRITRHLDLTHPDKYVCPGQEEQLQTLLRTLRGHRKIVVVAGAGISVSAGIPDFRSSHGLFTTLKKDHKLKASGKQLFDASVVYQDESMISSFHDMVRTLSKLSASAKPTAFHHLLARLAQEGRLLRLYTQNVDGIEASLPPLETKVPLEVKGPWPITIQLHGGLHTMVCQKCSNASSFEADLFKGPDPPLCGACERNEETRTAGGQRSRGIGKLRPRMVLYNEYNPDEEAIGSVVSADLRARPDALVVVGTSLKIPGVRRIVKEMCRVVRGRRNGTTVWINHDPLPSGKEFEDCWDLAIKGDCDKVALHAGLKRWDDKGEDDGRSFNECTEEEFDRAKSGNAEISVVITPQKPVKFANFTNGMPTPSSSSEDSLNPGKRSQSPTPSAPPKQNGARTKMVKKPSQPRKPRAKKTKAADASAKTVPLNKSFPSRKPTAAKESKVVKEPSRCKIEDVLNPIPPESARSNGPAPLELETKENNNNNVVHHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.18
5 0.2
6 0.22
7 0.24
8 0.27
9 0.26
10 0.32
11 0.33
12 0.34
13 0.34
14 0.32
15 0.29
16 0.27
17 0.29
18 0.25
19 0.23
20 0.26
21 0.28
22 0.29
23 0.29
24 0.26
25 0.24
26 0.21
27 0.19
28 0.13
29 0.1
30 0.08
31 0.08
32 0.08
33 0.08
34 0.07
35 0.06
36 0.07
37 0.07
38 0.07
39 0.05
40 0.06
41 0.12
42 0.19
43 0.27
44 0.32
45 0.38
46 0.45
47 0.55
48 0.66
49 0.71
50 0.76
51 0.8
52 0.85
53 0.9
54 0.91
55 0.9
56 0.86
57 0.82
58 0.79
59 0.75
60 0.68
61 0.63
62 0.61
63 0.57
64 0.51
65 0.45
66 0.37
67 0.34
68 0.36
69 0.31
70 0.31
71 0.27
72 0.29
73 0.35
74 0.37
75 0.34
76 0.33
77 0.31
78 0.27
79 0.28
80 0.27
81 0.22
82 0.23
83 0.28
84 0.32
85 0.38
86 0.41
87 0.4
88 0.42
89 0.41
90 0.41
91 0.37
92 0.27
93 0.22
94 0.19
95 0.16
96 0.12
97 0.1
98 0.07
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.06
106 0.07
107 0.09
108 0.14
109 0.14
110 0.16
111 0.16
112 0.18
113 0.18
114 0.22
115 0.28
116 0.29
117 0.32
118 0.35
119 0.4
120 0.44
121 0.5
122 0.55
123 0.54
124 0.58
125 0.65
126 0.66
127 0.63
128 0.59
129 0.52
130 0.44
131 0.38
132 0.29
133 0.19
134 0.16
135 0.15
136 0.12
137 0.11
138 0.1
139 0.1
140 0.1
141 0.1
142 0.06
143 0.06
144 0.07
145 0.08
146 0.09
147 0.1
148 0.09
149 0.11
150 0.14
151 0.15
152 0.14
153 0.15
154 0.14
155 0.15
156 0.18
157 0.23
158 0.21
159 0.26
160 0.26
161 0.26
162 0.28
163 0.33
164 0.3
165 0.26
166 0.25
167 0.22
168 0.22
169 0.22
170 0.21
171 0.16
172 0.15
173 0.14
174 0.15
175 0.13
176 0.14
177 0.15
178 0.15
179 0.13
180 0.18
181 0.2
182 0.18
183 0.19
184 0.19
185 0.17
186 0.18
187 0.17
188 0.12
189 0.11
190 0.09
191 0.08
192 0.06
193 0.06
194 0.05
195 0.06
196 0.06
197 0.06
198 0.07
199 0.11
200 0.12
201 0.13
202 0.15
203 0.17
204 0.2
205 0.25
206 0.25
207 0.21
208 0.21
209 0.22
210 0.22
211 0.21
212 0.19
213 0.14
214 0.14
215 0.13
216 0.13
217 0.11
218 0.1
219 0.1
220 0.15
221 0.12
222 0.14
223 0.14
224 0.14
225 0.17
226 0.18
227 0.18
228 0.15
229 0.16
230 0.16
231 0.16
232 0.18
233 0.16
234 0.15
235 0.14
236 0.13
237 0.12
238 0.12
239 0.11
240 0.11
241 0.13
242 0.14
243 0.14
244 0.14
245 0.15
246 0.14
247 0.15
248 0.19
249 0.19
250 0.22
251 0.21
252 0.21
253 0.21
254 0.2
255 0.2
256 0.17
257 0.17
258 0.15
259 0.16
260 0.17
261 0.18
262 0.18
263 0.19
264 0.2
265 0.22
266 0.29
267 0.35
268 0.36
269 0.35
270 0.36
271 0.36
272 0.36
273 0.4
274 0.34
275 0.33
276 0.33
277 0.32
278 0.31
279 0.28
280 0.25
281 0.17
282 0.14
283 0.08
284 0.06
285 0.04
286 0.04
287 0.04
288 0.03
289 0.03
290 0.03
291 0.03
292 0.05
293 0.06
294 0.06
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.06
301 0.05
302 0.06
303 0.05
304 0.05
305 0.05
306 0.05
307 0.05
308 0.06
309 0.07
310 0.12
311 0.19
312 0.23
313 0.24
314 0.31
315 0.36
316 0.38
317 0.44
318 0.45
319 0.4
320 0.41
321 0.42
322 0.42
323 0.45
324 0.47
325 0.47
326 0.45
327 0.46
328 0.41
329 0.44
330 0.43
331 0.36
332 0.36
333 0.33
334 0.31
335 0.3
336 0.3
337 0.26
338 0.21
339 0.22
340 0.16
341 0.15
342 0.14
343 0.14
344 0.13
345 0.15
346 0.18
347 0.15
348 0.15
349 0.15
350 0.15
351 0.14
352 0.16
353 0.14
354 0.12
355 0.12
356 0.11
357 0.11
358 0.11
359 0.11
360 0.12
361 0.12
362 0.12
363 0.14
364 0.17
365 0.22
366 0.23
367 0.24
368 0.22
369 0.23
370 0.23
371 0.23
372 0.28
373 0.28
374 0.28
375 0.27
376 0.28
377 0.28
378 0.29
379 0.27
380 0.2
381 0.18
382 0.16
383 0.18
384 0.21
385 0.21
386 0.2
387 0.21
388 0.21
389 0.2
390 0.21
391 0.18
392 0.15
393 0.14
394 0.15
395 0.13
396 0.14
397 0.12
398 0.13
399 0.13
400 0.12
401 0.12
402 0.1
403 0.12
404 0.16
405 0.17
406 0.17
407 0.19
408 0.25
409 0.3
410 0.3
411 0.36
412 0.36
413 0.35
414 0.38
415 0.38
416 0.33
417 0.27
418 0.27
419 0.23
420 0.21
421 0.24
422 0.2
423 0.19
424 0.2
425 0.21
426 0.24
427 0.27
428 0.31
429 0.29
430 0.3
431 0.33
432 0.36
433 0.43
434 0.46
435 0.47
436 0.48
437 0.52
438 0.59
439 0.65
440 0.65
441 0.65
442 0.62
443 0.6
444 0.62
445 0.66
446 0.63
447 0.6
448 0.64
449 0.64
450 0.68
451 0.69
452 0.69
453 0.67
454 0.7
455 0.74
456 0.76
457 0.79
458 0.82
459 0.84
460 0.87
461 0.91
462 0.93
463 0.94
464 0.93
465 0.91
466 0.89
467 0.9
468 0.85
469 0.8
470 0.77
471 0.7
472 0.65
473 0.58
474 0.51
475 0.41
476 0.4
477 0.37
478 0.34
479 0.34
480 0.3
481 0.39
482 0.44
483 0.5
484 0.51
485 0.53
486 0.56
487 0.6
488 0.65
489 0.66
490 0.69
491 0.66
492 0.66
493 0.71
494 0.68
495 0.68
496 0.66
497 0.63
498 0.64
499 0.68
500 0.69
501 0.68
502 0.64
503 0.6
504 0.61
505 0.61
506 0.58
507 0.58
508 0.56
509 0.52
510 0.52
511 0.48
512 0.42
513 0.34
514 0.33
515 0.28
516 0.24
517 0.22
518 0.26
519 0.28
520 0.3
521 0.31
522 0.29
523 0.27
524 0.27
525 0.27
526 0.24
527 0.25
528 0.25
529 0.28
530 0.34
531 0.37
532 0.36
533 0.39
534 0.4