Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4V509

Protein Details
Accession E4V509    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-35FWVLAPPKARPKARPKARPKARPSRGLQRAGHydrophilic
NLS Segment(s)
PositionSequence
11-45PKARPKARPKARPKARPSRGLQRAGRRGKAREKAR
Subcellular Location(s) mito 16.5, cyto_mito 10.833, nucl 6.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MPGGFWVLAPPKARPKARPKARPKARPSRGLQRAGRRGKAREKARQEQSQVKGFARGKRCCTSYKCLNAAFPLVPWSAVAALHCTLETAVLHASAPGTQHPCRGHKNMLPNCNEKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.66
4 0.75
5 0.81
6 0.82
7 0.84
8 0.9
9 0.91
10 0.9
11 0.9
12 0.88
13 0.87
14 0.83
15 0.83
16 0.8
17 0.79
18 0.76
19 0.75
20 0.77
21 0.74
22 0.74
23 0.68
24 0.66
25 0.66
26 0.69
27 0.67
28 0.66
29 0.68
30 0.7
31 0.73
32 0.73
33 0.69
34 0.68
35 0.64
36 0.61
37 0.54
38 0.45
39 0.45
40 0.42
41 0.43
42 0.43
43 0.42
44 0.41
45 0.42
46 0.44
47 0.42
48 0.43
49 0.45
50 0.45
51 0.48
52 0.46
53 0.44
54 0.42
55 0.38
56 0.35
57 0.28
58 0.2
59 0.16
60 0.12
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.11
84 0.16
85 0.17
86 0.23
87 0.28
88 0.34
89 0.41
90 0.46
91 0.5
92 0.5
93 0.6
94 0.62
95 0.66
96 0.66