Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V2X3

Protein Details
Accession E4V2X3   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-38DEEEEKKSKKKREGGKGKDKMNRGBasic
NLS Segment(s)
PositionSequence
20-35KKSKKKREGGKGKDKM
Subcellular Location(s) nucl 24, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
Amino Acid Sequences MDLLVLEEEEEEEEDEEEEKKSKKKREGGKGKDKMNRGSSSSYTVKATAEYEDGVVTAEEDGKRPSRWIMKDDEDDERRSPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.12
6 0.15
7 0.21
8 0.28
9 0.36
10 0.44
11 0.52
12 0.61
13 0.69
14 0.77
15 0.81
16 0.84
17 0.84
18 0.83
19 0.8
20 0.74
21 0.69
22 0.64
23 0.56
24 0.47
25 0.43
26 0.36
27 0.36
28 0.33
29 0.28
30 0.23
31 0.21
32 0.19
33 0.16
34 0.16
35 0.11
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.05
44 0.05
45 0.07
46 0.07
47 0.08
48 0.11
49 0.14
50 0.15
51 0.16
52 0.22
53 0.28
54 0.31
55 0.34
56 0.39
57 0.43
58 0.49
59 0.51
60 0.54
61 0.49
62 0.5
63 0.49