Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UQ81

Protein Details
Accession E4UQ81   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-109EEYLKAYKRKRKLDTFQARHPHLHydrophilic
NLS Segment(s)
PositionSequence
46-60RLRFRRDLALKKAKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGLLNWWSNLRDSMHSVKETETRTAHRLANSPPELWSSKDHIASRRLRFRRDLALKKAKKENRSIVPVVMRYPEGPYWPYTPEDDMEEYLKAYKRKRKLDTFQARHPHLQIHQTDANPFHAYNPWNGETFLLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.33
5 0.36
6 0.36
7 0.35
8 0.32
9 0.32
10 0.34
11 0.37
12 0.37
13 0.34
14 0.36
15 0.34
16 0.4
17 0.38
18 0.36
19 0.32
20 0.33
21 0.31
22 0.29
23 0.29
24 0.25
25 0.26
26 0.31
27 0.32
28 0.33
29 0.39
30 0.45
31 0.5
32 0.54
33 0.55
34 0.53
35 0.54
36 0.54
37 0.56
38 0.58
39 0.58
40 0.57
41 0.64
42 0.64
43 0.65
44 0.71
45 0.66
46 0.61
47 0.61
48 0.59
49 0.55
50 0.57
51 0.53
52 0.45
53 0.42
54 0.38
55 0.31
56 0.24
57 0.18
58 0.13
59 0.14
60 0.12
61 0.11
62 0.12
63 0.13
64 0.14
65 0.15
66 0.16
67 0.15
68 0.16
69 0.15
70 0.16
71 0.15
72 0.15
73 0.14
74 0.13
75 0.12
76 0.14
77 0.17
78 0.19
79 0.25
80 0.32
81 0.4
82 0.5
83 0.58
84 0.65
85 0.7
86 0.77
87 0.82
88 0.8
89 0.81
90 0.81
91 0.76
92 0.69
93 0.62
94 0.56
95 0.48
96 0.48
97 0.4
98 0.38
99 0.39
100 0.36
101 0.39
102 0.36
103 0.36
104 0.3
105 0.29
106 0.24
107 0.25
108 0.25
109 0.26
110 0.3
111 0.29
112 0.28
113 0.28