Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V527

Protein Details
Accession E4V527    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-124EAGEWRRAKRRMREREKERRREREAEMKREKEREKERRKEWKRGREREIKMEWSBasic
NLS Segment(s)
PositionSequence
76-121RRAKRRMREREKERRREREAEMKREKEREKERRKEWKRGREREIKM
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVEHESMTNMIFLQRPASQDSNMSKTSPPPPYSAVENMGAVKRPEGAGMTPHEDAVEFKRHQEKMDQLCAEAGEWRRAKRRMREREKERRREREAEMKREKEREKERRKEWKRGREREIKMEWSRAKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.22
4 0.24
5 0.23
6 0.28
7 0.33
8 0.34
9 0.34
10 0.33
11 0.29
12 0.31
13 0.37
14 0.39
15 0.36
16 0.33
17 0.35
18 0.36
19 0.39
20 0.37
21 0.32
22 0.25
23 0.24
24 0.23
25 0.21
26 0.2
27 0.17
28 0.14
29 0.12
30 0.11
31 0.11
32 0.1
33 0.09
34 0.1
35 0.12
36 0.16
37 0.15
38 0.15
39 0.14
40 0.13
41 0.14
42 0.14
43 0.18
44 0.15
45 0.18
46 0.24
47 0.25
48 0.26
49 0.28
50 0.32
51 0.31
52 0.37
53 0.35
54 0.28
55 0.28
56 0.27
57 0.23
58 0.2
59 0.16
60 0.17
61 0.18
62 0.21
63 0.27
64 0.34
65 0.41
66 0.47
67 0.57
68 0.61
69 0.7
70 0.78
71 0.82
72 0.87
73 0.91
74 0.92
75 0.91
76 0.9
77 0.87
78 0.82
79 0.78
80 0.77
81 0.75
82 0.75
83 0.75
84 0.72
85 0.7
86 0.72
87 0.69
88 0.68
89 0.7
90 0.71
91 0.72
92 0.75
93 0.8
94 0.83
95 0.87
96 0.89
97 0.89
98 0.89
99 0.89
100 0.89
101 0.88
102 0.88
103 0.87
104 0.85
105 0.81
106 0.8
107 0.73
108 0.73
109 0.69