Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UVZ2

Protein Details
Accession E4UVZ2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
156-186YCCMTRPGERIAKRRRCKSKIGAPHRINQTEHydrophilic
NLS Segment(s)
PositionSequence
167-171AKRRR
Subcellular Location(s) cyto 13, cyto_nucl 11.5, nucl 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR031309  Ribosomal_L5_C  
IPR022803  Ribosomal_L5_dom_sf  
IPR031310  Ribosomal_L5_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00281  Ribosomal_L5  
PF00673  Ribosomal_L5_C  
Amino Acid Sequences MAQAEGNDKSSNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYNDVVKLGNEENARRKLTSEFCTIGKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKKNFSETGNFGFGINEHIDLGIKYDPGIGIYGMDFYCCMTRPGERIAKRRRCKSKIGAPHRINQTETIKWFKSRFEGIVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.51
4 0.52
5 0.53
6 0.52
7 0.5
8 0.5
9 0.48
10 0.39
11 0.34
12 0.28
13 0.21
14 0.2
15 0.18
16 0.12
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.11
24 0.13
25 0.14
26 0.15
27 0.17
28 0.17
29 0.18
30 0.18
31 0.17
32 0.17
33 0.18
34 0.17
35 0.14
36 0.13
37 0.14
38 0.15
39 0.14
40 0.12
41 0.12
42 0.14
43 0.13
44 0.15
45 0.13
46 0.16
47 0.17
48 0.21
49 0.26
50 0.29
51 0.31
52 0.29
53 0.3
54 0.3
55 0.34
56 0.35
57 0.32
58 0.29
59 0.28
60 0.32
61 0.31
62 0.28
63 0.24
64 0.21
65 0.18
66 0.23
67 0.25
68 0.23
69 0.25
70 0.31
71 0.31
72 0.36
73 0.44
74 0.41
75 0.41
76 0.44
77 0.44
78 0.36
79 0.38
80 0.34
81 0.26
82 0.22
83 0.23
84 0.2
85 0.22
86 0.22
87 0.19
88 0.17
89 0.15
90 0.15
91 0.14
92 0.13
93 0.11
94 0.14
95 0.15
96 0.14
97 0.16
98 0.15
99 0.14
100 0.14
101 0.13
102 0.16
103 0.23
104 0.32
105 0.38
106 0.42
107 0.45
108 0.46
109 0.47
110 0.47
111 0.42
112 0.38
113 0.36
114 0.35
115 0.34
116 0.32
117 0.28
118 0.22
119 0.2
120 0.18
121 0.13
122 0.1
123 0.08
124 0.08
125 0.08
126 0.08
127 0.1
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.06
136 0.06
137 0.06
138 0.08
139 0.07
140 0.07
141 0.06
142 0.07
143 0.08
144 0.08
145 0.1
146 0.1
147 0.12
148 0.15
149 0.23
150 0.32
151 0.37
152 0.47
153 0.57
154 0.66
155 0.73
156 0.81
157 0.84
158 0.81
159 0.83
160 0.83
161 0.83
162 0.83
163 0.84
164 0.85
165 0.78
166 0.81
167 0.8
168 0.74
169 0.65
170 0.61
171 0.56
172 0.51
173 0.52
174 0.51
175 0.45
176 0.47
177 0.47
178 0.44
179 0.44
180 0.43